Recombinant Aeromonas hydrophila subsp. hydrophila Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Protease HtpX is a 290-amino acid protein derived from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240). It belongs to the EC 3.4.24.- enzyme class and functions as a zinc-dependent metalloprotease . Key features include:

PropertyDetail
Gene NamehtpX (Ordered Locus: AHA_1493)
Uniprot IDA0KID0
Molecular Weight~38 kDa (mature form)
Expression RegionAmino acids 1–290
Storage Conditions-20°C (long-term); 4°C (working aliquots, ≤1 week)
TagDetermined during production (Tris-based buffer with 50% glycerol)

Biological Function and Role in Virulence

HtpX contributes to A. hydrophila pathogenicity through:

  • Stress response: Acts as a heat shock protein, aiding survival under environmental stress .

  • Virulence modulation: Proteases like HtpX degrade host tissues and evade immune responses. For example:

    • Mutants lacking homologous proteases (e.g., AhpB) show 100-fold reduced lethality in rainbow trout .

    • Extracellular proteases induce protective antibody responses, as seen with recombinant EPR vaccines in mice (80% survival post-challenge) .

Vaccine Development

  • Recombinant proteases (e.g., EPR2-3 fusion protein) elicit high antibody titers and confer protection against A. hydrophila infections .

  • Survival Rates:

    Vaccine TypeSurvival RateChallenge Model
    EPR2-3 subunit≥80%ICR mice
    Inactivated A. hydrophila<20%ICR mice

Enzymatic Activity Studies

  • Substrate specificity: Cleaves elastin and casein, with elastolytic activity linked to virulence .

  • Inhibitors: EDTA and 1,10-phenanthroline suppress activity, confirming metalloprotease classification .

Comparative Analysis with Related Proteases

ProteaseOrganismRole in VirulenceMolecular Weight
HtpXA. hydrophilaStress response, immune evasion38 kDa
AhpBA. hydrophilaElastin degradation, LD50 reduction38 kDa
LasBP. aeruginosaTissue damage, biofilm formation33 kDa

HtpX shares structural homology with LasB from P. aeruginosa but differs in regulatory mechanisms .

Challenges and Future Directions

  • Stability issues: Repeated freeze-thaw cycles degrade activity .

  • Immunogenicity: Requires adjuvant optimization for vaccine efficacy .

  • Unresolved questions: Role in biofilm formation and interactions with other virulence factors (e.g., T3SS) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; AHA_1493; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Target Names
htpX
Target Protein Sequence
MKRIMLFLVTNLAVMLVLGVVLNILFSVLGINKSSISGLLVFCAVFGFGGSFISLLMSKW MAKRSYGVQVIEQPRNETEHWLVSTVARQAREAGIKMPEVGIYDSPEMNAFATGARRDDS LVAVSSGLLYSMSRDEAEAVLAHEVSHVANGDMVTLTLIQGVVNTFVMFFARIVAGVISN FFSSNNDEESSSTGGFAYMITVFVLEMLFGVLASIIVMWFSRQREFRADAGAAKLAGRDK MIAALQRLSRGAEPQLEGSMMAFGINGKRSMSELFMSHPPIEQRIAALRG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the general structural characterization of Protease HtpX in Aeromonas hydrophila?

Protease HtpX from Aeromonas hydrophila is a membrane-bound zinc metalloproteinase belonging to the M48 peptidase family. Similar to its homologs in other bacteria, it contains transmembrane segments and conserved metalloprotease domains. Structurally, it is characterized by multiple hydrophobic regions that likely serve as transmembrane segments, though the exact membrane topology may vary between species. The protein typically contains approximately 290 amino acids and features conserved motifs essential for its proteolytic function .

Based on homology with better-characterized HtpX proteins, the A. hydrophila HtpX likely possesses a zinc-binding domain with conserved residues critical for its metalloprotease activity. Computational analysis of HtpX homologs has shown that these proteins are generally slightly acidic to basic in nature, thermally stable, and sufficiently hydrophobic to reside in and interact with biological membranes .

How does HtpX function in the bacterial membrane protein quality control system?

HtpX functions as a key component in the proteolytic quality control of membrane proteins. It works by recognizing and degrading misfolded or damaged membrane proteins that could potentially disrupt membrane integrity and cellular function. Studies in E. coli have demonstrated that HtpX often works in conjunction with other proteases, particularly FtsH, forming a comprehensive quality control system for membrane proteins .

The protease participates in the degradation pathway by cleaving specific peptide bonds in target proteins, thereby contributing to protein turnover and homeostasis maintenance. This activity becomes especially important under stress conditions when the accumulation of abnormal proteins could otherwise lead to cellular dysfunction. In pathogenic bacteria like A. hydrophila, this protein quality control function may also play roles in stress adaptation and virulence expression .

What are the known physiological substrates of Protease HtpX?

Scientists have developed model substrates to study HtpX activity. For example, researchers constructed an in vivo semiquantitative assay system for E. coli HtpX using a specially designed model substrate that allows for convenient detection of protease activity. Similar approaches could be adapted for studying A. hydrophila HtpX .

What expression systems are optimal for producing recombinant A. hydrophila HtpX?

For recombinant expression of A. hydrophila HtpX, E. coli-based expression systems have proven effective, similar to those used for HtpX homologs from other bacterial species. The use of vectors like pET series (similar to pET32a used for other A. hydrophila proteins) with appropriate promoters allows for controlled and efficient expression .

When expressing membrane proteins like HtpX, considerations should include:

  • Selection of appropriate E. coli strains (BL21(DE3), for example) that are deficient in certain proteases to minimize degradation of the recombinant protein

  • Optimization of induction conditions using IPTG at concentrations typically around 0.5-1.0 mM

  • Temperature modulation during expression (often lowered to 16-25°C) to facilitate proper protein folding

  • Consideration of fusion tags that enhance solubility and facilitate purification

The expression protocol might need to be optimized specifically for A. hydrophila HtpX due to its hydrophobic nature and potential toxicity to the host cells when overexpressed .

How can researchers effectively purify recombinant HtpX while maintaining its native conformation and activity?

Purification of membrane proteins like HtpX requires specific approaches to maintain their structural integrity and functional activity. A recommended protocol based on successful purification of similar proteins includes:

  • Membrane fraction isolation: After cell disruption (typically by sonication or French press), differential centrifugation at ~100,000×g separates the membrane fraction containing HtpX.

  • Solubilization: Use appropriate detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100 at optimized concentrations to solubilize the membrane proteins without denaturing them.

  • Affinity chromatography: If the recombinant protein contains a His-tag (as commonly engineered), immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective. Binding should be performed in the presence of the selected detergent.

  • Buffer optimization: Include zinc ions (typically ZnCl₂ at 10-50 μM) in the purification buffers to maintain the metalloprotease activity of HtpX.

  • Storage considerations: After purification, the protein should be stored in a buffer containing glycerol (typically 10-50%) and detergent at concentrations above the critical micelle concentration to prevent protein aggregation .

For A. hydrophila HtpX specifically, reconstitution in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been successful with similar proteins, and aliquoting with glycerol addition (30-50% final concentration) is recommended for long-term storage at -20°C or -80°C to avoid repeated freeze-thaw cycles .

What are the recommended methods to assess purity and activity of the recombinant HtpX?

Comprehensive assessment of purified recombinant HtpX should include multiple analytical techniques:

  • Purity assessment:

    • SDS-PAGE analysis (>90% purity is typically desired for research applications)

    • Western blotting using antibodies against the fusion tag or the HtpX protein itself

    • Size exclusion chromatography to verify monodispersity and absence of aggregates

  • Activity assessment:

    • Proteolytic activity assays using model substrates such as those developed for E. coli HtpX

    • Zymography using casein or gelatin as substrates embedded in polyacrylamide gels

    • In vivo activity assays in bacterial cells expressing the recombinant protein

  • Structural integrity validation:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to verify proper folding

The novel in vivo semiquantitative assay system developed for E. coli HtpX detection could be adapted for A. hydrophila HtpX, allowing for convenient assessment of protease activity and the effects of mutations in conserved regions .

How can researchers design experiments to identify specific substrates of A. hydrophila HtpX?

Substrate identification for HtpX remains challenging but several methodological approaches can be employed:

  • Proteomics-based methods:

    • Comparative proteomics between wild-type and HtpX-knockout A. hydrophila strains to identify accumulated proteins in the knockout

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with mass spectrometry to quantify protein degradation rates

    • Terminal amine isotopic labeling of substrates (TAILS) to identify proteolytic cleavage sites

  • Model substrate approach:

    • Design and construction of model substrates similar to the approach used for E. coli HtpX

    • Development of fusion proteins containing potential membrane protein substrates linked to reporter proteins (e.g., GFP or luciferase) for in vivo monitoring

  • Crosslinking experiments:

    • Use of catalytically inactive HtpX mutants (e.g., with mutations in the conserved zinc-binding motif) combined with crosslinking agents to trap enzyme-substrate complexes

    • Pulldown assays with tagged HtpX followed by mass spectrometry analysis

Researchers should consider using a catalytically inactive mutant of HtpX (created by site-directed mutagenesis of the active site) as a control in these experiments to distinguish between specific proteolytic substrates and non-specific binding partners .

What model systems are appropriate for studying HtpX function in A. hydrophila pathogenesis?

To investigate the role of HtpX in A. hydrophila pathogenesis, several model systems can be employed:

  • In vitro cellular models:

    • Human intestinal epithelial cell lines (e.g., Caco-2) to study bacterial interaction with host cells

    • Macrophage cell lines to investigate the role of HtpX in intracellular survival

    • Protocols should include infection assays with wild-type A. hydrophila versus htpX knockout strains

  • Fish infection models:

    • Crucian carp or zebrafish models that have been established for A. hydrophila infection studies

    • Parameters to measure include survival rates, bacterial load in tissues, and inflammatory responses

    • Complementation with the wild-type htpX gene should rescue the phenotype of knockout strains

  • Mouse infection models:

    • For investigating potential roles in mammalian host infection

    • Both systemic and localized infection models can be used

When designing these experiments, researchers should create isogenic mutants with in-frame deletion of the htpX gene and complement these mutants with the wild-type gene to confirm specificity of observed phenotypes. Measurement of virulence parameters should include tissue dissemination capacity, intestinal permeability, and host immune responses .

How can researchers determine the stress conditions that regulate HtpX expression in A. hydrophila?

To investigate the regulation of HtpX expression under various stress conditions:

  • Transcriptional analysis:

    • qRT-PCR to quantify htpX mRNA levels under different stress conditions

    • RNA-seq for genome-wide transcriptional changes in response to stressors

    • Reporter gene assays using the htpX promoter fused to fluorescent proteins or luciferase

  • Protein expression analysis:

    • Western blotting with antibodies against HtpX or epitope tags

    • Proteomic analysis using mass spectrometry

    • Pulse-chase experiments to determine protein stability under stress conditions

  • Stress conditions to test:

    • Heat shock (42-45°C for varying durations)

    • Oxidative stress (H₂O₂, paraquat)

    • Membrane stress (ethanol, detergents at sub-inhibitory concentrations)

    • pH stress (acidic and alkaline conditions)

    • Antibiotic stress (sub-inhibitory concentrations of antibiotics targeting cell envelope)

For comprehensive analysis, time-course experiments should be performed to determine both immediate and adaptive responses. Correlation of HtpX expression with bacterial survival under these conditions would provide insights into its physiological role in stress adaptation .

What are the essential residues for HtpX catalytic activity and how can they be identified?

The catalytic activity of HtpX as a zinc metalloprotease depends on specific conserved residues that can be identified through several approaches:

  • Sequence alignment and structural analysis:

    • Multiple sequence alignment of HtpX homologs to identify highly conserved residues

    • Computational prediction of conserved domains and metal-binding sites

    • Homology modeling based on related M48 family metalloproteases

  • Site-directed mutagenesis:

    • Systematic mutation of conserved residues, particularly those in the predicted active site

    • Specific focus on potential zinc-binding motifs (typically involving histidine and glutamate residues)

    • Creation of a library of mutants with varying degrees of predicted impact on catalytic activity

  • Functional assays:

    • In vivo protease activity assays using model substrates to assess the impact of mutations

    • Complementation studies in htpX-deficient strains to determine which mutations abolish function

    • Metal-binding assays to confirm the role of specific residues in zinc coordination

Based on studies of HtpX homologs, researchers should pay particular attention to the conserved HEXXH motif common in zinc metalloproteases, as well as other conserved residues that may play roles in substrate binding or structural stability. The established in vivo assay systems for HtpX activity would be valuable in analyzing the effects of these mutations .

How does the metal ion binding affect the activity and stability of A. hydrophila HtpX?

Metal ion binding plays a crucial role in both the activity and stability of HtpX as a metalloprotease:

  • Metal binding characterization:

    • Isothermal titration calorimetry (ITC) to determine binding affinity for different metal ions

    • Inductively coupled plasma mass spectrometry (ICP-MS) to quantify metal content in purified protein

    • Spectroscopic methods such as circular dichroism to assess structural changes upon metal binding

  • Effects on protease activity:

    • Enzymatic assays in the presence of various metal ions (Zn²⁺, Ca²⁺, Mg²⁺, etc.) at different concentrations

    • Use of metal chelators (EDTA, EGTA) to assess dependency on specific metals

    • Recovery of activity through metal ion reconstitution after chelation

  • Structural impacts:

    • Analysis of active pocket formation upon metal binding using computational methods like CASTpFold

    • Thermal stability assessments in the presence and absence of various metal ions

    • Limited proteolysis experiments to determine if metal binding affects protein conformational dynamics

Research with related proteases has shown that the binding of Ca²⁺ to recombinant proteases can result in the formation of larger active pockets, potentially enhancing substrate accessibility and catalytic efficiency. Similar effects might be observed with A. hydrophila HtpX and should be investigated systematically .

Table 1: Predicted effects of different metal ions on HtpX activity based on studies of related metalloproteases

Metal IonExpected Effect on ActivityConcentration Range for TestingPotential Mechanism
Zn²⁺Essential for activity1-100 μMPrimary catalytic ion in active site
Ca²⁺Enhancement of activity0.1-10 mMFormation of larger active pocket
Mg²⁺Moderate enhancement1-10 mMStructural stabilization
Mn²⁺Potential substitute for Zn²⁺10-100 μMAlternative catalytic ion
Cu²⁺Potential inhibition10-100 μMCompetitive binding to active site
EDTAComplete inhibition1-10 mMChelation of essential metal ions

What is the substrate specificity profile of A. hydrophila HtpX and how does it compare to homologs from other bacteria?

To establish the substrate specificity profile of A. hydrophila HtpX and compare it with homologs:

  • Peptide library screening:

    • Use of synthetic peptide libraries with systematic variations in amino acid composition

    • Fluorogenic or chromogenic substrates to facilitate high-throughput screening

    • Analysis of cleavage products by mass spectrometry to identify cleavage sites

  • Protein substrate profiling:

    • Testing against various membrane and non-membrane proteins to determine preference

    • Analysis of cleavage patterns using SDS-PAGE and mass spectrometry

    • Comparison of degradation efficiencies between wild-type and substrate variants

  • Comparative analysis with homologs:

    • Parallel testing of A. hydrophila HtpX alongside homologs from E. coli, A. salmonicida, and other bacteria

    • Phylogenetic analysis combined with substrate preference data to identify evolutionary patterns

    • Structural modeling to identify variations in substrate-binding regions that might explain functional differences

  • Context-dependent activity:

    • Assessment of how membrane environment affects substrate recognition and cleavage

    • Testing whether substrate specificity changes under different stress conditions

    • Investigation of potential cofactors or binding partners that might modulate substrate specificity

Based on computational proteomic studies of HtpX homologs, researchers should pay attention to conserved exposed residues that might be involved in substrate recognition, as well as conserved buried residues that contribute to the structural integrity of the active site .

What is the role of HtpX in A. hydrophila stress response and adaptation?

To investigate the role of HtpX in A. hydrophila stress response:

  • Stress survival assays:

    • Compare survival of wild-type and htpX mutant strains under various stressors

    • Heat shock (42-45°C for varying durations)

    • Oxidative stress (H₂O₂, paraquat)

    • Membrane stress (ethanol, detergents at sub-inhibitory concentrations)

    • Antibiotic exposure (particularly cell wall-targeting antibiotics)

  • Physiological changes:

    • Membrane integrity assessment using fluorescent dyes

    • Protein aggregation analysis under stress conditions

    • Electron microscopy to observe morphological changes

    • Metabolomic analysis to identify changes in cellular metabolism

  • Global response analysis:

    • Transcriptomic profiling comparing wild-type and htpX mutant responses to stress

    • Proteomic analysis to identify differentially accumulated proteins

    • Epistasis studies with other stress response genes to position HtpX in regulatory networks

While specific data on A. hydrophila HtpX is limited, evidence from homologs suggests that HtpX plays an important role in the quality control of membrane proteins, particularly under stress conditions that can lead to protein misfolding or damage. This function is likely conserved in A. hydrophila and contributes to bacterial adaptation to environmental changes .

How does HtpX contribute to A. hydrophila virulence and host-pathogen interactions?

To establish the role of HtpX in A. hydrophila virulence:

  • Virulence assays:

    • In vivo infection models (fish or mice) comparing wild-type and htpX knockout strains

    • Measurement of bacterial dissemination to tissues

    • Host survival analysis

    • Histopathological examination of infected tissues

  • Host-pathogen interaction studies:

    • Adhesion and invasion assays with epithelial cell lines

    • Phagocytosis and intracellular survival in macrophages

    • Effect on epithelial barrier integrity and tight junction proteins

    • Host immune response measurement (cytokine production, immune cell activation)

  • Virulence gene expression:

    • Analysis of how HtpX affects the expression of known virulence factors

    • Secretome analysis comparing wild-type and htpX mutant strains

    • Regulatory network analysis to position HtpX in virulence regulation pathways

While direct evidence for A. hydrophila HtpX's role in virulence is not detailed in the provided search results, studies with other A. hydrophila proteases have demonstrated their importance in virulence. For example, the secretory serine protease Ssp1 disrupts tight junction integrity and is essential for pathogenicity. HtpX, by maintaining membrane protein quality control, may indirectly affect the expression or function of membrane-associated virulence factors .

Can HtpX be targeted for developing novel antimicrobials against A. hydrophila infections?

To evaluate HtpX as a potential antimicrobial target:

  • Target validation:

    • Confirmation of HtpX essentiality or significant contribution to virulence/survival

    • Structural and functional distinctions between bacterial HtpX and host proteases

    • Assessment of potential for resistance development

  • Inhibitor development approaches:

    • Structure-based drug design using computational models of HtpX

    • High-throughput screening of chemical libraries against purified recombinant HtpX

    • Peptide-based inhibitors designed to mimic substrates but resist cleavage

    • Metal chelators specific for the HtpX active site

  • Evaluation of candidate inhibitors:

    • In vitro enzymatic assays with purified HtpX

    • Bacterial growth inhibition assays

    • Cytotoxicity testing in mammalian cells

    • Efficacy testing in infection models

  • Combination therapy potential:

    • Synergy testing with conventional antibiotics

    • Evaluation as resistance-breaking adjuvants

Although HtpX itself has not been specifically validated as an antimicrobial target in the provided search results, protease inhibitors have shown promise as therapeutic agents in other bacterial infections. The development of recombinant HtpX protein with enhanced activity (similar to the 61.9-fold increase in fermentation level observed with recombinant DX-3-htpX protease) suggests potential for directed evolution approaches to create modified versions with altered specificities that could serve as the basis for antimicrobial development .

How can structural biology approaches enhance our understanding of A. hydrophila HtpX function?

Advanced structural biology techniques can provide crucial insights into HtpX function:

  • Cryo-electron microscopy:

    • Determination of high-resolution structure of membrane-embedded HtpX

    • Visualization of HtpX in complex with substrate proteins

    • Analysis of conformational changes during the catalytic cycle

  • X-ray crystallography:

    • Structure determination of soluble domains or engineered variants

    • Co-crystallization with inhibitors or substrate mimics

    • Mapping of metal-binding sites and substrate-binding pockets

  • NMR spectroscopy:

    • Dynamic analysis of specific domains during substrate binding

    • Investigation of conformational changes upon metal binding

    • Characterization of the membrane-protein interface

  • Integrative structural approaches:

    • Combination of computational modeling with experimental data

    • Molecular dynamics simulations to understand protein flexibility

    • Cross-linking mass spectrometry to identify domain interactions

Recent advances in AlphaFold and similar tools provide opportunities for computational structure prediction that can guide experimental approaches. For instance, AlphaFold3 has been used to predict the tertiary structure of related proteases, and similar approaches could be applied to A. hydrophila HtpX. The D3 pocket and its binding to metal ions can be analyzed using tools like CASTpFold to understand the structural basis of substrate recognition and catalysis .

What evolutionary insights can be gained from comparative analysis of HtpX across different bacterial species?

Evolutionary analysis of HtpX can reveal important functional and adaptive insights:

  • Phylogenetic analysis:

    • Construction of comprehensive phylogenetic trees of HtpX across diverse bacterial species

    • Correlation of evolutionary relationships with ecological niches and pathogenicity

    • Identification of clade-specific sequence features that might reflect functional adaptations

  • Selective pressure analysis:

    • Calculation of dN/dS ratios to identify regions under positive or purifying selection

    • Per-site evolutionary rate estimation to pinpoint functionally important residues

    • Detection of coevolving residues that might be functionally coupled

  • Horizontal gene transfer assessment:

    • Analysis of GC content and codon usage bias to detect potential horizontal gene transfer events

    • Comparison of gene and species phylogenies to identify incongruencies

    • Evaluation of synteny conservation across related species

  • Structure-function correlations:

    • Mapping of conserved and variable regions onto structural models

    • Identification of species-specific insertions or deletions that might confer unique functions

    • Analysis of surface properties and electrostatic potential variations across homologs

Computational proteomic studies have shown that Polynucleobacter necessarius might be an ancestral organism for some HtpX-containing bacteria, suggesting evolutionary relationships that could inform understanding of functional adaptations. Additionally, the identification of conserved residues (19 conserved & exposed residues; 38 conserved & buried residues) provides insights into functionally important regions that have been maintained throughout evolution .

How can systems biology approaches integrate HtpX function into broader cellular networks in A. hydrophila?

Systems biology approaches can place HtpX within its broader cellular context:

  • Multi-omics integration:

    • Combination of transcriptomics, proteomics, and metabolomics data from wild-type and htpX mutant strains

    • Network analysis to identify pathways affected by HtpX function

    • Identification of regulatory hubs that control HtpX expression or are affected by HtpX activity

  • Protein-protein interaction network:

    • Pull-down assays with tagged HtpX to identify interaction partners

    • Bacterial two-hybrid screening for protein interactions

    • Cross-linking mass spectrometry to identify transient interactions

    • Construction of comprehensive interaction maps centered on HtpX

  • Pathway analysis:

    • Integration with known stress response pathways

    • Connections to virulence regulation networks

    • Metabolic pathway impacts of HtpX function

  • Mathematical modeling:

    • Development of kinetic models of HtpX activity within membrane protein quality control

    • Predictive modeling of system-wide effects of HtpX perturbation

    • Integration of experimental data with model predictions to refine understanding

Studies of HtpX homologs have identified several functional partners, including fmt, ftsH, grpE, and others. For A. hydrophila HtpX, similar protein-protein interaction analysis through tools like STRING could reveal its connection to other cellular components and processes. Pathway analysis through Pathway Commons could position HtpX within broader cellular networks and identify unexpected connections to other biological processes .

What are common technical challenges in working with recombinant HtpX and how can they be addressed?

Researchers working with recombinant HtpX face several technical challenges:

  • Protein expression issues:

    • Challenge: Low expression levels or formation of inclusion bodies

    • Solutions:

      • Use lower induction temperatures (16-20°C)

      • Employ specialized expression strains (C41/C43 for membrane proteins)

      • Test different fusion tags (MBP, SUMO) to enhance solubility

      • Optimize codon usage for the expression host

  • Purification difficulties:

    • Challenge: Maintaining protein stability during extraction from membranes

    • Solutions:

      • Screen different detergents (DDM, LMNG, GDN) for optimal solubilization

      • Include protease inhibitors and appropriate metal ions in all buffers

      • Perform purification steps at 4°C to minimize degradation

      • Consider on-column folding protocols for proteins recovered from inclusion bodies

  • Activity preservation:

    • Challenge: Loss of enzymatic activity during purification or storage

    • Solutions:

      • Add stabilizing agents like glycerol (30-50%) and trehalose (6%)

      • Maintain zinc or other required metal ions in all buffers

      • Aliquot and flash-freeze samples to avoid repeated freeze-thaw cycles

      • Store at -80°C for long-term preservation

  • Functional assay limitations:

    • Challenge: Difficulty in measuring activity of a membrane-bound protease

    • Solutions:

      • Adapt the in vivo semiquantitative assay system developed for E. coli HtpX

      • Develop fluorogenic substrates specific for HtpX

      • Use reconstituted proteoliposomes to mimic the native membrane environment

      • Employ cell-based reporter systems for indirect measurement of activity

Recommendations for storage include using Tris/PBS-based buffer with 6% trehalose at pH 8.0, adding glycerol to a final concentration of 30-50%, and avoiding repeated freeze-thaw cycles by storing small aliquots at -80°C .

How can researchers address the challenge of distinguishing HtpX activity from other proteases in complex biological samples?

Distinguishing HtpX activity from other proteases requires specific approaches:

  • Genetic approaches:

    • Use of clean deletion mutants of htpX in A. hydrophila

    • Complementation studies with wild-type and catalytically inactive HtpX variants

    • Creation of reporter strains expressing HtpX under inducible promoters

  • Biochemical methods:

    • Development of HtpX-specific substrates based on known cleavage preferences

    • Use of selective inhibitors to block activities of other proteases

    • Immunoprecipitation of HtpX to isolate it from complex mixtures before activity assays

  • Analytical techniques:

    • Zymography under conditions optimized for HtpX activity

    • Mass spectrometry identification of cleavage products with HtpX-specific patterns

    • Activity-based protein profiling using selective probes

  • Controlled expression systems:

    • Heterologous expression of A. hydrophila HtpX in protease-deficient backgrounds

    • Titration of expression levels to correlate with observed activity

    • Comparative analysis across multiple bacterial species expressing different levels of HtpX homologs

The in vivo protease activity assay system developed for E. coli HtpX provides a valuable approach that could be adapted for A. hydrophila HtpX. This system enables semiquantitative and convenient detection of protease activity and can distinguish between different protease variants, making it useful for studying the specific contribution of HtpX to observed proteolytic activities .

What strategies can resolve contradictory findings about HtpX function in different experimental systems?

Addressing contradictory findings requires systematic approaches:

  • Standardization of experimental conditions:

    • Detailed documentation of genetic backgrounds used

    • Precise definition of growth and stress conditions

    • Standardized protocols for protein expression and purification

    • Consistent methodologies for activity measurements

  • Controlled comparative studies:

    • Direct side-by-side comparison of HtpX from different sources under identical conditions

    • Chimeric protein construction to identify domains responsible for functional differences

    • Cross-complementation studies using htpX genes from different species

  • Resolving genetic context effects:

    • Analysis of genetic backgrounds for suppressor mutations

    • Identification of strain-specific factors that might affect HtpX function

    • Consideration of epistatic interactions with other genes

  • Technical verification:

    • Replication by independent laboratories using shared materials

    • Use of multiple, orthogonal techniques to measure the same parameters

    • Validation of key findings with both in vitro and in vivo approaches

  • Systematic literature review and meta-analysis:

    • Comprehensive analysis of published studies on HtpX and related proteins

    • Identification of variables that correlate with observed functional differences

    • Development of unified models that incorporate seemingly contradictory findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.