Recombinant Aeromonas hydrophila subsp. hydrophila UPF0060 membrane protein AHA_2410 (AHA_2410)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance; additional fees will apply.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
AHA_2410; UPF0060 membrane protein AHA_2410
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Target Names
AHA_2410
Target Protein Sequence
MGELKTMGLFLVTALAEILGCYLPYLWLTQGRSVWLLLPAGLSLMLFAWLLSLHPTAAGR VYAAYGGVYIFVAILWLWLVDGIRPSLWDLVGSLVALCGMAIIMFAPREA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How should recombinant AHA_2410 be stored and handled in a laboratory setting?

    For optimal stability and functionality of recombinant AHA_2410, the following storage and handling protocols are recommended:

    ParameterDetails
    FormLyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0)
    Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for storage
    Storage-20°C/-80°C (long-term); 4°C for working aliquots (≤1 week)
    StabilityDegrades with repeated freeze-thaw cycles

    It is explicitly recommended to avoid repeated freeze-thaw cycles. For reconstitution, the vial should be briefly centrifuged prior to opening to bring contents to the bottom. After reconstitution, aliquoting with glycerol addition (final concentration 5-50%) is advised for long-term storage at -20°C/-80°C .

  • What expression systems are used for recombinant AHA_2410 production?

    Recombinant AHA_2410 is predominantly expressed in E. coli expression systems, which offer high yield and cost-effectiveness for membrane protein production . The protein is typically fused to an N-terminal His-tag to facilitate purification . Alternative expression hosts that could be considered include:

    • Yeast expression systems

    • Baculovirus expression systems

    • Mammalian cell expression systems

    The choice of expression system depends on research requirements for post-translational modifications, protein folding, and downstream applications. E. coli remains the most common choice due to its high yield (~112 mg/L at shake flask level has been reported for similar membrane proteins from A. hydrophila) .

  • How is the purity of recombinant AHA_2410 assessed?

    The purity of recombinant AHA_2410 is typically assessed using SDS-PAGE analysis, with commercial preparations generally exceeding 90% purity . Additional analytical methods that can be employed include:

    • Western blotting with anti-His antibodies to confirm identity

    • Size exclusion chromatography to evaluate homogeneity

    • Mass spectrometry to verify molecular weight and sequence integrity

    • Circular dichroism to assess secondary structure composition

    For research applications requiring higher purity, additional chromatography steps such as ion exchange or size exclusion chromatography may be implemented following the initial Ni²⁺-NTA affinity purification .

Advanced Research Questions

  • What methodologies are recommended for studying AHA_2410-lipid interactions?

    Investigating AHA_2410-lipid interactions requires specialized approaches for membrane protein analysis. Based on current research with similar proteins, the following methodologies are recommended:

    • Native Mass Spectrometry (Native MS): This technique can identify specific lipids that co-purify with AHA_2410, suggesting functionally important interactions. Similar approaches have been successfully applied to membrane proteins like AmtB and TRAAK.

    • Lipidomics: Comprehensive analysis of lipids associated with purified AHA_2410 can reveal preferential interactions with specific lipid classes or species.

    • Reconstitution in Model Membrane Systems:

      1. Nanodiscs, which provide a defined lipid environment

      2. Liposomes of varying composition to assess functional activity

      3. Lipid cubic phases for crystallization attempts

    • Molecular Dynamics Simulations: Computational approaches can predict lipid binding sites and interaction energetics, guiding experimental design.

    • Fluorescence-based Assays: Using environmentally sensitive probes to detect conformational changes upon lipid binding .

    These methods should be complementary to overcome the limitations of individual techniques when studying membrane protein-lipid interactions.

  • How does AHA_2410 compare with other characterized membrane proteins in Aeromonas hydrophila?

    AHA_2410 differs significantly from well-characterized A. hydrophila membrane proteins in several aspects:

    ProteinFunctionTransmembrane Residue FrequencyVaccine PotentialAMR Association
    AHA_2410Unknown (UPF0060 family)Predicted highUnder studyHypothetical
    OmpCOsmolarity adaptation, porin activityLowerConfirmedLinked to β-lactamase
    AerolysinCytotoxin, pore-formingVariableNoVirulence factor

    Unlike OmpC, which has been extensively characterized as a porin involved in osmolarity adaptation, AHA_2410 lacks experimentally validated functional annotations . OmpC has demonstrated immunogenic potential, generating high endpoint titers (>1:40,000) in murine models and exhibiting cross-reactivity with different Aeromonas strains .

    AHA_2410's lack of characterized virulence factors distinguishes it from aerolysin or OmpC, which directly contribute to pathogenicity or immune evasion. The protein displays distinctive transmembrane characteristics, with MeMDLM-based predictions suggesting a higher density of transmembrane residues compared to average membrane proteins .

  • What experimental approaches can be used to determine the function of AHA_2410?

    Given the unconfirmed function of AHA_2410, a multi-faceted experimental approach is recommended:

    1. Comparative Genomics and Bioinformatics:

      • Phylogenetic analysis within the UPF0060 family

      • Structural prediction using AlphaFold 3 or similar tools

      • Identification of conserved domains and motifs

    2. Gene Knockout and Complementation:

      • CRISPR-Cas9 mediated knockout in A. hydrophila

      • Phenotypic characterization under various stress conditions

      • Complementation with wild-type and mutant variants

    3. Protein-Protein Interaction Studies:

      • Bacterial two-hybrid assays

      • Co-immunoprecipitation with potential interacting partners

      • Proximity labeling approaches (BioID, APEX)

    4. Functional Assays Based on Hypothesized Roles:

      • Membrane integrity assessments using fluorescent dyes

      • Stress response experiments (osmotic, pH, temperature)

      • Ion flux measurements if channel/transporter activity is suspected

    5. Structural Studies:

      • Cryo-EM analysis of purified protein

      • X-ray crystallography following optimized crystallization

      • NMR studies of isotopically labeled protein

    These approaches should be conducted iteratively, with findings from one method informing the design of subsequent experiments.

  • How can machine learning models like MeMDLM be applied to studying AHA_2410 and similar membrane proteins?

    Machine learning models, particularly Masked Diffusion Language Models (MDLMs) like MeMDLM, offer innovative approaches for studying membrane proteins like AHA_2410:

    1. De Novo Sequence Design: MeMDLM can generate novel membrane protein sequences with transmembrane characteristics similar to AHA_2410. This capability allows for the design of protein variants with potentially improved properties for experimental studies .

    2. Transmembrane Topology Prediction: MeMDLM-based models achieve higher accuracy in predicting transmembrane residues compared to traditional approaches. For AHA_2410, these models predict a transmembrane residue frequency closer to experimentally verified membrane proteins (25.737 residues per 100 amino acids) .

    3. Motif Scaffolding: For functional studies, MeMDLM can reconstruct sequences around conserved motifs with greater biological similarity to natural sequences, as measured by cosine similarity metrics (0.768 for transmembrane domains) .

    4. Physicochemical Property Prediction: Analysis of AHA_2410 with MeMDLM embeddings can predict properties such as per-residue solubility and membrane localization with performance comparable to wild-type ESM-2-150M embeddings .

    5. Structural Prediction Integration: MeMDLM-generated sequences can be visualized with AlphaFold 3 to predict alpha-helical bundles and other structural features characteristic of membrane proteins like AHA_2410 .

    Comparisons between different models show MeMDLM outperforms alternatives like ProtGPT2 for membrane protein design, with lower pseudo-perplexity scores (3.819 vs 20.554) for transmembrane domain prediction .

  • What challenges exist in expressing and purifying AHA_2410, and how can they be overcome?

    Expression and purification of AHA_2410 present several technical challenges common to membrane proteins:

    1. Low Expression Levels:

      • Solution: Optimize codon usage for the expression host

      • Solution: Use strong inducible promoters (e.g., T7)

      • Solution: Screen multiple expression strains (BL21, C41/C43 for membrane proteins)

    2. Protein Misfolding and Aggregation:

      • Solution: Express at lower temperatures (16-25°C)

      • Solution: Use fusion partners that enhance solubility (MBP, SUMO)

      • Solution: Include chemical chaperones in growth media

    3. Detergent Selection for Solubilization:

      • Solution: Screen multiple detergents (DDM, LMNG, CHAPS)

      • Solution: Use lipid-detergent mixtures to stabilize the protein

      • Solution: Consider membrane mimetics like nanodiscs or SMALPs

    4. Purification Optimization:

      • Solution: Two-step purification using Ni²⁺-NTA followed by size exclusion

      • Solution: Include stabilizing additives in buffers (glycerol, specific lipids)

      • Solution: Optimize imidazole concentration gradients to improve purity

    5. Functional Reconstitution:

      • Solution: Test various lipid compositions for reconstitution

      • Solution: Optimize protein-to-lipid ratios

      • Solution: Verify functional state using activity assays or biophysical techniques

    High yields (~112 mg/L at shake flask level) have been reported for similar A. hydrophila membrane proteins using optimized E. coli expression systems and purification from inclusion bodies , suggesting similar approaches may be effective for AHA_2410.

  • How might AHA_2410 be utilized in antimicrobial resistance studies?

    AHA_2410 offers several potential applications in antimicrobial resistance (AMR) research:

    1. Membrane Permeability Studies:

      • As a membrane protein, AHA_2410 could be used to investigate membrane permeability alterations in resistant strains of A. hydrophila

      • Transport assays using reconstituted AHA_2410 could reveal whether it contributes to antibiotic efflux or uptake

    2. Target Validation:

      • If AHA_2410 plays a role in membrane integrity, it may represent a novel target for antimicrobial development

      • Inhibition assays using purified protein could identify compounds that specifically interact with AHA_2410

    3. Expression Analysis in Resistant Strains:

      • Comparative transcriptomics and proteomics to determine if AHA_2410 expression changes in multidrug-resistant isolates

      • Correlation of expression levels with minimum inhibitory concentrations (MICs) of various antibiotics

    4. Structure-Function Relationship:

      • Structural characterization of AHA_2410 could reveal domains that interact with antimicrobials

      • Site-directed mutagenesis of key residues could determine their role in resistance mechanisms

    5. Immunological Studies:

      • Similar to OmpC, AHA_2410 could potentially elicit antibodies that recognize multiple Aeromonas strains

      • These antibodies could be evaluated for their ability to enhance antibiotic efficacy through increased membrane permeability

    A. hydrophila strains exhibit multidrug resistance linked to membrane permeability alterations, making membrane proteins like AHA_2410 valuable for understanding and potentially counteracting resistance mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.