Recombinant Aeromonas punctata UPF0126 membrane protein (yadS)

What is the UPF0126 membrane protein (yadS) from Aeromonas punctata?

The UPF0126 membrane protein (yadS) from Aeromonas punctata is a 210-amino acid protein (Q9R9S0) that belongs to the UPF0126 protein family. This membrane-associated protein is expressed in Aeromonas punctata (also known as Aeromonas caviae), a gram-negative, rod-shaped bacterium . The complete amino acid sequence is: MQTLVEQIVYISDMFGTAVFAFSGVLVAGRLRMDGFGVMVLAAVTAIGGGTIRDMILGATPVFWVRDPLYIWVVIATALIGMWMVKLPRRMPWYVLPVADAFGLALFTVIGAQKALNFGTSGLIAVLMGTMTGVAGGMIRDVLAREVPMVLQKEIYATACILGGILYTLSLEVGVDRVSAMLISMLGVFGLRVAAIYWHLSLPTFSLQRN . The protein is characterized by its transmembrane domains and is part of a protein family whose specific functions are not yet fully characterized.

What expression systems are commonly used for producing recombinant yadS protein?

The recombinant Aeromonas punctata UPF0126 membrane protein (yadS) is primarily expressed using E. coli expression systems . This heterologous expression approach is preferred due to E. coli's well-established genetic tools, rapid growth, and high protein yield capabilities. For example, the commercially available recombinant yadS protein with N-terminal His-tag is produced in E. coli . The choice of E. coli as an expression host allows for efficient production of soluble membrane proteins when optimized conditions are employed. Similar approaches have been demonstrated successful for other Aeromonas proteins, such as the Aeromonas punctata prolyl endopeptidase, which achieved expression yields of 3.0 g per liter of culture broth using E. coli BL21 strain in high cell-density fermentation systems .

What purification strategies are recommended for recombinant yadS protein?

For effective purification of recombinant yadS protein, a multi-step approach is recommended based on strategies employed for similar membrane proteins. The process typically begins with cell lysis via sonication, followed by clarification of the lysate by centrifugation . For His-tagged yadS protein, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins serves as the primary purification step. This can be followed by ion exchange chromatography using High-performance Q sepharose FF and hydrophobic interaction chromatography with Phenyl sepharose 6 FF for enhanced purity . For highest purity (>95%), an additional size exclusion chromatography step may be incorporated. Critical considerations include maintaining appropriate detergent concentrations throughout purification to prevent protein aggregation while preserving the native membrane protein structure. The purified protein is typically obtained as a lyophilized powder after buffer exchange and can be reconstituted in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the optimal conditions for solubilizing and stabilizing yadS during structural studies?

For structural studies of recombinant yadS protein, optimal solubilization and stabilization conditions need to be carefully established. As a membrane protein with multiple transmembrane domains, yadS requires specific detergent systems to maintain its native conformation outside the lipid bilayer. Based on protocols developed for similar membrane proteins, a screening approach using a panel of detergents is recommended, including mild detergents such as n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration (CMC). Stabilization can be enhanced by incorporating cholesterol hemisuccinate (CHS) at 10% of the detergent concentration. For crystallization trials, shorter chain detergents like octyl glucose neopentyl glycol (OGNG) may facilitate crystal contacts while maintaining protein stability. Throughout the purification process, maintaining a consistent detergent concentration above CMC is crucial to prevent protein aggregation. Additionally, incorporating stabilizing agents such as glycerol (20-30%) in storage buffers and keeping the ionic strength at moderate levels (150-300 mM NaCl) helps preserve protein stability during long-term storage and structural studies.

How can I design experiments to elucidate the functional role of yadS in Aeromonas punctata membranes?

To elucidate the functional role of yadS in Aeromonas punctata membranes, a multi-faceted experimental approach is recommended. Begin with generating yadS knockout mutants using CRISPR-Cas9 or homologous recombination techniques to assess the phenotypic effects on bacterial growth, membrane integrity, and stress responses. Comparative transcriptomic and proteomic analyses between wild-type and yadS-deficient strains can identify affected pathways. For protein interaction studies, a bacterial two-hybrid system or co-immunoprecipitation combined with mass spectrometry will help identify binding partners. Localization studies using fluorescently tagged yadS expressed at physiological levels can determine its distribution within bacterial membranes. Functional complementation assays can be performed by reintroducing wild-type or mutated yadS into knockout strains to validate the significance of specific protein domains. Additionally, testing the yadS-deficient strain under various stress conditions (pH, temperature, osmotic stress) and comparing its virulence potential to wild-type strains in infection models would provide insights into its role in bacterial pathogenicity, particularly since Aeromonas species are known to possess various virulence factors and secretion systems that contribute to their pathogenicity .

What bioinformatic approaches can help predict the structure and function of the UPF0126 protein family?

Comprehensive bioinformatic analysis of the UPF0126 protein family, including yadS, requires a multi-level approach to predict structure and function. Begin with sequence-based analyses using multiple sequence alignments (MSAs) of UPF0126 family members across bacterial species to identify conserved residues that may indicate functional importance. Employ transmembrane topology prediction tools such as TMHMM, Phobius, or MEMSAT to map membrane-spanning regions. For structural predictions, utilize AlphaFold2 or RoseTTAFold to generate accurate 3D models, followed by refinement with molecular dynamics simulations in a lipid bilayer environment. Functional prediction should incorporate genomic context analysis, examining the operons containing yadS in various Aeromonas species to identify potential functional associations. Protein-protein interaction predictions using STRING or similar databases may reveal interaction networks. Additionally, investigate structural similarities to functionally characterized proteins using fold recognition methods like HHpred. Gene co-expression analysis across different Aeromonas growth conditions may provide clues about yadS regulation and function. Finally, integrate these findings with available experimental data on membrane proteins in Aeromonas species to develop testable hypotheses about yadS function in bacterial physiology or pathogenicity.

How does yadS from Aeromonas punctata compare with homologous proteins in other Aeromonas species?

The UPF0126 membrane protein (yadS) from Aeromonas punctata shows significant homology with similar proteins found in other Aeromonas species. Comparative genomic analysis reveals that yadS is conserved across the Aeromonas genus with sequence identity typically ranging from 75-95% depending on the species . The highest conservation is observed in the transmembrane domains, suggesting functional importance of these regions. For instance, the yadS protein from Aeromonas punctata (210 amino acids) shares structural and sequence similarities with the E. coli UPF0126 inner membrane protein yadS (207 amino acids) . Notable differences between species are primarily found in loop regions connecting the transmembrane domains, which may reflect adaptation to different environmental niches or host interactions. Phylogenetic analysis places the Aeromonas punctata yadS protein closer to the Aeromonas caviae cluster, consistent with taxonomic classifications that sometimes consider these as synonymous species names . The conservation of this protein across Aeromonas species suggests it may play an important role in basic cellular functions rather than species-specific adaptations, though the exact function remains to be fully characterized.

What role might yadS play in Aeromonas virulence or pathogenicity?

While the specific role of yadS in Aeromonas virulence has not been directly established, several lines of evidence suggest potential involvement in pathogenicity mechanisms. As a membrane protein, yadS could contribute to membrane integrity or permeability, which are critical for bacterial survival during host infection. Comparative genomic analyses of Aeromonas species have identified numerous virulence factors and secretion systems that contribute to pathogenicity . Although yadS is not specifically listed among the classical virulence factors such as hemolysins, enterotoxins, or components of secretion systems, its conservation across Aeromonas species suggests a potential role in basic physiological processes that may indirectly support virulence. Aeromonas species possess various secretion systems, including type II (Exe T2SS), type III (T3SS), and type VI (T6SS) secretion systems, which are differentially distributed among species and strains . The membrane-associated nature of yadS raises the possibility that it might interact with these secretion systems or contribute to their proper assembly or function. To definitively establish any role in virulence, research would need to examine yadS knockout mutants in infection models and assess changes in virulence factor expression, secretion system functionality, and host cell interactions.

What are common challenges in expressing and purifying recombinant membrane proteins like yadS?

Expression and purification of recombinant membrane proteins like yadS present several technical challenges that require specific strategies to overcome. The primary issues include low expression levels, protein misfolding, aggregation, and toxicity to host cells. To address these challenges, researchers should consider the following approaches: First, optimize expression conditions by testing different E. coli strains (C41(DE3), C43(DE3), or Lemo21(DE3)) specifically designed for membrane protein expression . Modulate expression temperature (typically lowering to 16-20°C) and inducer concentration to reduce formation of inclusion bodies. For improved solubility, co-express molecular chaperones like GroEL/GroES or fusion partners such as MBP or SUMO. During purification, selection of appropriate detergents is critical; mild detergents like DDM or LMNG are typically more effective than harsh detergents like SDS for maintaining native structure. Additionally, incorporate stability-enhancing additives in purification buffers, such as glycerol (10-20%) and specific lipids that might be required for proper folding. For His-tagged constructs, optimize imidazole concentrations during binding and elution steps to reduce non-specific binding while maximizing target protein recovery. Finally, assess protein quality using size-exclusion chromatography to confirm monodispersity and employ techniques like circular dichroism to verify proper folding.

What omics approaches can advance our understanding of yadS function in Aeromonas species?

Integrated omics approaches offer powerful strategies to decipher the functional role of yadS in Aeromonas species. Transcriptomics using RNA-seq can identify conditions that upregulate or downregulate yadS expression, providing clues about its physiological roles. Comparing transcriptomes of wild-type and yadS knockout strains under various environmental conditions (pH stress, osmotic stress, nutrient limitation) would reveal pathways affected by yadS deletion. Proteomics approaches, particularly membrane proteomics using techniques like cell surface shaving followed by mass spectrometry, can identify proteins co-regulated with yadS or altered in abundance upon yadS deletion. Interactomics using proximity labeling techniques such as BioID or APEX2 fused to yadS can capture transient protein interactions in the native membrane environment. Metabolomics comparing wild-type and yadS mutants may reveal altered metabolite profiles, particularly if yadS functions in transport or signaling. For systems-level understanding, integrating these multiple omics datasets through computational approaches like correlation networks could identify functional modules associated with yadS. Additionally, comparative genomics across the Aeromonas genus can provide evolutionary insights by correlating yadS sequence variations with specific phenotypic traits or ecological niches . These comprehensive omics approaches would generate testable hypotheses about yadS function that could then be validated through targeted molecular and biochemical experiments.

How might structural studies of yadS contribute to membrane protein research?

Structural studies of yadS from Aeromonas punctata have significant potential to advance membrane protein research through several avenues. As a member of the UPF0126 protein family with unknown function, a high-resolution structure would provide foundational insights into this protein family's architecture and potential mechanisms. Membrane proteins remain underrepresented in structural databases despite their biological importance, making each new structure valuable for improving prediction algorithms and understanding membrane protein folding principles. Advanced structural techniques applicable to yadS include cryo-electron microscopy, which is increasingly powerful for membrane proteins, and X-ray crystallography if well-diffracting crystals can be obtained. Integration of structural data with molecular dynamics simulations would reveal dynamic aspects of yadS function, particularly how it interacts with the lipid bilayer. If yadS proves amenable to structural studies, it could serve as a model system for investigating membrane protein stability, folding, and dynamics. Structure-guided experiments, such as cross-linking studies or electron paramagnetic resonance (EPR) spectroscopy, could validate structural models and provide insights into conformational changes. Comparative analysis with structures of other bacterial membrane proteins might reveal unexpected structural relationships to proteins of known function, potentially illuminating yadS function. Furthermore, if yadS is involved in Aeromonas pathogenicity, structural insights could inform the development of inhibitors targeting this or related proteins in pathogenic bacteria.

What potential applications exist for yadS in synthetic biology and biotechnology?

The recombinant Aeromonas punctata UPF0126 membrane protein (yadS) presents several promising applications in synthetic biology and biotechnology. As a well-expressed bacterial membrane protein, yadS could serve as a scaffold for engineering membrane protein chimeras with novel functions. The protein's relatively small size (210 amino acids) and successful expression in E. coli systems make it amenable to genetic manipulation and high-yield production . For biosensor development, yadS could be engineered to incorporate sensing domains that respond to specific environmental signals, potentially creating whole-cell biosensors for environmental monitoring. In synthetic biology, yadS could be utilized as a membrane anchor for display of functional peptides or enzymes on bacterial surfaces, creating engineered bacteria with novel surface properties. If further research reveals transport functions, engineered yadS variants could enhance cellular uptake of specific compounds, improving bioproduction processes. For structural biology applications, yadS could serve as a fusion partner to stabilize other membrane proteins for structural studies. Additionally, understanding the natural function of yadS might inspire biomimetic approaches to create synthetic membranes with specific permeability or sensing properties. The established purification protocols for His-tagged recombinant yadS provide a foundation for these applications, though each would require extensive optimization and functional validation . As research on yadS advances, additional biotechnological applications are likely to emerge, particularly if unique functional properties are discovered.