Recombinant Aeromonas salmonicida ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Expression System: Produced in E. coli with an N-terminal His tag for purification .

Structural Features:

PropertyDetails
Amino Acid SequenceMAATGEALTTQGYISHHLHHLQVGSGFWTVNIDSMIFSVILGALFIWIFRKVAATATSGVPGKLQCF...
Molecular Weight~34 kDa (theoretical), with SDS-PAGE migration anomalies noted
Gene InformationatpB (ASA_4356); Synonyms: ATP synthase F0 sector subunit a, F-ATPase subunit 6
UniProt IDA4STP9

Purity & Stability:

  • ≥90% purity via SDS-PAGE

  • Storage: Lyophilized powder at -20°C/-80°C in Tris/PBS buffer with 6% trehalose

  • Reconstitution requires glycerol (5-50%) to prevent aggregation

Functional Role in Bacterial Physiology

The atpB-encoded subunit facilitates proton channeling through the F₀ complex, enabling ATP synthesis via the F₁ sector. Key findings:

  • Genetic Regulation: Adjacent abcA gene (encoding an ATP-binding cassette transporter) modulates atpB expression in heterologous systems, suggesting transcriptional coupling .

  • Pathogenicity Link: Homologous ATP synthase subunits in Salmonella (e.g., atpB) are critical for maintaining cytoplasmic pH and ATP homeostasis during macrophage infection . Experimental inactivation of atpB disrupts virulence by altering proton gradients .

Research Applications

Experimental Use Cases:

  • SDS-PAGE Analysis: Primary application for purity verification and molecular weight estimation .

  • ELISA Development: Commercial kits utilize this recombinant protein for antibody detection (e.g., CBM15 product CSB-CF015070AUI) .

  • ATPase Activity Studies: Used to investigate proton translocation inhibition mechanisms (e.g., MgtC protein interactions in Salmonella) .

Technical Notes:

  • Avoid repeated freeze-thaw cycles; aliquot working solutions stored at 4°C degrade within 7 days .

  • Activity assays require reconstitution at 0.1-1.0 mg/mL in deionized water .

Pathogenic Implications

Studies on homologous systems reveal ATP synthase’s role in bacterial survival under stress:

  • Salmonella mutants lacking atpB exhibit elevated ATP levels (≈2.5-fold) and cytoplasmic acidification (pH ≈6.2 vs. wild-type ≈7.1), impairing intracellular survival .

  • MgtC virulence factor binds ATP synthase’s a subunit, reducing ATP hydrolysis by 40% and synthesis by 55% to counteract phagosomal acidity .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
atpB; ASA_4356; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Aeromonas salmonicida (strain A449)
Target Names
atpB
Target Protein Sequence
MAATGEALTTQGYISHHLHHLQVGSGFWTVNIDSMIFSVILGALFIWIFRKVAATATSGV PGKLQCFVEMVVEFVDDTVKGIFHGKSKLIAPLALTVFIWVFLMNLMDLIPVDYLPYTAQ VLGIPYLRVVPSADVNITMSMALGVFALIIIYSIKMKGVSGFVKELTLNPFNHWALIPVN LALELVTLLSKPISLGLRLFGNMYAGELVFILIAGLLPWWSQWLLSVPWALFHILVITLQ AFIFMVLTIVYLSMASEDH
Uniprot No.

Target Background

Function
This protein plays a crucial role in the proton channel, directly facilitating the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aeromonas salmonicida ATP synthase subunit a (atpB)?

ATP synthase subunit a (atpB) is an essential component of the F0 sector of the ATP synthase complex in Aeromonas salmonicida, a bacterial pathogen responsible for furunculosis in salmonid fish. The protein functions as part of the proton channel that facilitates ATP synthesis through proton translocation across the bacterial membrane. The full-length protein consists of 259 amino acids and contains multiple transmembrane domains that anchor it within the bacterial membrane . This protein is encoded by the atpB gene (locus name ASA_4356) in A. salmonicida strain A449 .

What are the optimal storage conditions for recombinant atpB protein?

For maintaining optimal stability and activity of recombinant Aeromonas salmonicida ATP synthase subunit a (atpB), the following storage conditions are recommended:

  • Long-term storage: Maintain at -20°C or -80°C, preferably in single-use aliquots

  • Buffer composition: Tris-based buffer containing 50% glycerol for liquid formulations, or Tris/PBS-based buffer with 6% trehalose (pH 8.0) for lyophilized preparations

  • Working stocks: Store at 4°C for a maximum of one week

  • Handling precautions: Avoid repeated freeze-thaw cycles as this can significantly compromise protein integrity and functional activity

For lyophilized preparations, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol for improved stability .

How can recombinant atpB be used in immunological studies of Aeromonas salmonicida infections?

Recombinant atpB can serve as a valuable tool in immunological research related to A. salmonicida infections through several methodological approaches:

  • Subunit vaccine development: atpB can be evaluated as a potential subunit vaccine candidate against A. salmonicida infections in fish. Experimental subunit vaccines have shown efficacy against A. salmonicida infection in rainbow trout through in silico screening approaches .

  • ELISA-based diagnostics: The recombinant protein can be employed in enzyme-linked immunosorbent assays (ELISA) to detect antibodies produced in response to A. salmonicida infection, offering a specific diagnostic tool .

  • Immunohistochemical studies: Recombinant atpB can be used to generate specific antibodies for tracking bacterial distribution in infected tissues, similar to immunohistochemical studies of immune responses in turbot experimentally infected with A. salmonicida .

  • Immune response profiling: The protein can facilitate investigation of innate immune parameters such as lysozyme (LSZ) and alkaline phosphatase (AKP) activities, which have been shown to be elevated in Atlantic salmon challenged with A. salmonicida .

What purification methods are most effective for His-tagged recombinant atpB?

Purification of His-tagged recombinant Aeromonas salmonicida ATP synthase subunit a (atpB) requires specialized approaches due to its membrane protein characteristics:

  • Expression system: E. coli has been successfully employed as an expression host for recombinant atpB with N-terminal His-tags .

  • Purification protocol:

    • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or similar resins

    • SDS-PAGE analysis to verify purity (>90% purity is achievable)

    • Buffer optimization to maintain protein stability during purification

  • Detergent considerations: As a membrane protein, atpB requires appropriate detergents during extraction and purification to maintain its native conformation.

  • Quality control: Verification of purity by SDS-PAGE is essential before using the protein in downstream applications .

  • Final formulation: The purified protein can be maintained in Tris-based buffer with stabilizing agents such as glycerol or trehalose .

How does atpB contribute to understanding the virulence mechanisms of Aeromonas salmonicida?

While ATP synthase components like atpB are primarily involved in energy metabolism rather than direct virulence, research into these proteins contributes to our understanding of A. salmonicida pathogenesis in several ways:

  • Energy requirement during infection: ATP synthase is essential for generating energy required for bacterial survival and proliferation during infection processes. Understanding atpB function provides insights into how A. salmonicida maintains energy homeostasis in host environments .

  • Relationship with virulence systems: While atpB itself is not a virulence factor, energy production is critical for the function of actual virulence systems like the type-three secretion system (T3SS), which has been identified as a major virulence determinant in A. salmonicida .

  • Stress adaptation: ATP synthase function may contribute to bacterial adaptation to environmental stresses encountered during infection, including pH changes, nutrient limitation, and host immune responses .

  • Therapeutic target potential: Components of essential metabolic pathways like ATP synthase represent potential targets for antimicrobial development, particularly important given the emerging antibiotic resistance in A. salmonicida strains .

What structural biology approaches can be applied to study atpB?

Several structural biology techniques can be applied to investigate the structure-function relationships of recombinant Aeromonas salmonicida ATP synthase subunit a (atpB):

  • X-ray crystallography: Challenging for membrane proteins like atpB, but potentially feasible with proper detergent selection, protein engineering, and crystallization condition optimization.

  • Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins and large complexes, cryo-EM could reveal the structure of atpB within the context of the complete ATP synthase complex.

  • Nuclear Magnetic Resonance (NMR): Solution NMR or solid-state NMR can provide information about specific domains or regions of atpB, particularly in different functional states.

  • Computational modeling: Homology modeling and molecular dynamics simulations can predict structural features and dynamic behaviors based on the known amino acid sequence .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Valuable for mapping flexible regions and protein-protein interaction interfaces within the ATP synthase complex.

How does atpB compare with other ATP synthase subunits in Aeromonas salmonicida?

Comparing atpB with other ATP synthase subunits reveals important functional and structural relationships:

SubunitGeneLocationFunctionKey Characteristics
Subunit a (atpB)atpBF0 sectorProton channel259 amino acids, multiple transmembrane domains
Subunit c (atpE)atpEF0 sectorProton translocation ringForms oligomeric ring structure, smaller size
Other F0 subunitsVariousF0 sectorMembrane anchor, proton transportVary in size and specific functions
F1 subunitsVariousF1 sectorATP synthesis/hydrolysisSoluble components with catalytic activity

Both atpB and atpE are components of the F0 sector embedded in the membrane, but they have distinct structural features and specific roles in the proton translocation mechanism . While atpB forms part of the stationary elements of the proton channel, atpE subunits form the rotating ring that converts proton flow into mechanical energy.

What is known about sequence conservation of atpB across different bacterial species?

The ATP synthase subunit a (atpB) shows varying degrees of sequence conservation across bacterial species:

  • Functional domains: Regions critical for proton channel formation and interaction with other ATP synthase components show higher conservation across species.

  • Transmembrane regions: Hydrophobic transmembrane domains tend to show higher conservation than loop regions.

  • Species-specific variations: Loop regions and certain transmembrane segments can vary considerably between different bacterial species, reflecting adaptation to specific environments and energy requirements.

  • Potential for selective targeting: Regions of atpB that differ between pathogenic bacteria and host organisms represent potential targets for species-specific inhibitors.

  • Evolutionary relationships: Phylogenetic analysis of atpB sequences can provide insights into evolutionary relationships between different bacterial species and strains.

What are common challenges when expressing recombinant atpB and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Aeromonas salmonicida ATP synthase subunit a (atpB):

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage, use specialized E. coli strains designed for membrane protein expression, adjust induction conditions (temperature, inducer concentration, induction time)

  • Protein misfolding and aggregation:

    • Challenge: Improper folding leading to inclusion body formation

    • Solution: Expression at lower temperatures (16-20°C), co-expression with chaperones, addition of specific detergents during extraction

  • Purification difficulties:

    • Challenge: Maintaining protein stability during purification

    • Solution: Use appropriate detergents throughout purification, include stabilizing agents like glycerol, work at 4°C, minimize purification time

  • Functional assessment:

    • Challenge: Verifying that the purified protein is correctly folded and functional

    • Solution: Reconstitution into proteoliposomes for functional assays, structural analysis by circular dichroism or other methods

  • Storage stability:

    • Challenge: Protein degradation during storage

    • Solution: Store in appropriate buffer with stabilizers, aliquot to avoid freeze-thaw cycles, store at -20°C or -80°C

How can researchers verify the proper folding and activity of recombinant atpB?

Verifying the structural integrity and functional activity of recombinant atpB requires multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Fluorescence spectroscopy to assess tertiary structure

    • Size-exclusion chromatography to evaluate oligomeric state

    • Thermal stability assays to determine protein stability

  • Functional assessment:

    • Reconstitution into liposomes for proton translocation assays

    • Assembly with other ATP synthase components to assess complex formation

    • Proton gradient-dependent ATP synthesis assays when incorporated into complete complexes

  • Interaction studies:

    • Binding assays with known interaction partners from the ATP synthase complex

    • Cross-linking studies to capture native interactions

    • Co-purification with other ATP synthase components

  • Quality control standards:

    • SDS-PAGE showing >90% purity

    • Western blot with anti-His antibodies to verify tag accessibility

    • Mass spectrometry to confirm protein identity and integrity

How might atpB research contribute to developing new treatments for Aeromonas infections in aquaculture?

Research on atpB has significant potential to advance treatment options for Aeromonas infections in aquaculture:

  • Subunit vaccine development: atpB could serve as a component in subunit vaccines against A. salmonicida. Experimental subunit vaccines have already shown promise in rainbow trout . Detailed characterization of immunogenic epitopes in atpB could lead to more effective vaccine formulations.

  • Drug target identification: As an essential component of energy metabolism, ATP synthase represents a potential target for novel antimicrobial compounds. Structure-based drug design targeting atpB could lead to new antibiotics with specific activity against Aeromonas species.

  • Biomarker development: Knowledge of atpB structure and function could facilitate the development of diagnostic tools for early detection of A. salmonicida infections, enabling more timely intervention in aquaculture settings.

  • Understanding resistance mechanisms: While ATP synthase is not directly involved in antibiotic resistance, research on essential metabolic pathways may reveal vulnerabilities that could be exploited to overcome resistance to current antibiotics .

  • Immunomodulatory approaches: Understanding the interaction between bacterial components like atpB and the host immune system could lead to strategies that enhance fish immune responses against A. salmonicida infections .

What emerging technologies might enhance our understanding of atpB function in the context of ATP synthase complex?

Several cutting-edge technologies show promise for advancing our understanding of atpB function:

  • Cryo-electron tomography: This technique could reveal the native structure of ATP synthase complexes in bacterial membranes, providing insights into how atpB interacts with other components in its natural environment.

  • Single-molecule techniques: Methods such as single-molecule FRET or force spectroscopy could track conformational changes in atpB during the catalytic cycle of ATP synthase.

  • Integrative structural biology: Combining multiple structural techniques (X-ray crystallography, cryo-EM, NMR, computational modeling) could provide a more complete picture of atpB structure and dynamics.

  • Advanced genetic tools: CRISPR-Cas9 and related technologies could enable precise genetic manipulation of atpB in A. salmonicida to study the effects of specific mutations on protein function and bacterial physiology.

  • Systems biology approaches: High-throughput proteomics and metabolomics could reveal how atpB function integrates with broader metabolic networks in A. salmonicida, particularly during infection processes and under various environmental stresses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.