Recombinant Aeromonas salmonicida ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Aeromonas salmonicida ATP Synthase Subunit b (atpF)

Recombinant Aeromonas salmonicida ATP synthase subunit b (atpF) is a protein that is produced using genetic engineering techniques. Specifically, the gene encoding the full-length Aeromonas salmonicida ATP synthase subunit b (atpF) is inserted into a host organism, such as E. coli, and expressed to produce the protein . The recombinant protein often includes a His-tag, which facilitates purification .

Characteristics

  • Full Length: The recombinant protein is a full-length version of the ATP synthase subunit b (atpF) .

  • Source Organism: The protein originates from Aeromonas salmonicida, a bacterium known to cause furunculosis in fish .

  • Expression Host: E. coli is commonly used to express the recombinant protein .

  • His-Tag: An N-terminal His-tag is typically added to the protein to simplify purification using affinity chromatography .

Function and Significance

ATP synthase is an enzyme complex that produces adenosine triphosphate (ATP), the primary energy currency in cells. ATP synthase is composed of several subunits, including subunit b (atpF), which plays a crucial role in the enzyme's structure and function.

Potential Applications

  1. Vaccine Development: Recombinant Aeromonas salmonicida atpF protein has potential use as a subunit vaccine candidate against A. salmonicida infections in fish. Experimental subunit vaccines utilizing recombinant proteins have demonstrated significantly lower mortalities in fish compared to control groups .

  2. Research Purposes: Recombinant atpF proteins can be used in research to study the structure, function, and interactions of ATP synthase .

  3. Drug Discovery: These proteins can be utilized in screening assays to identify potential inhibitors of ATP synthase, which could serve as antibacterial agents .

Aeromonas salmonicida and Vaccine Development

Aeromonas salmonicida is the causative agent of furunculosis, a significant disease affecting salmonid aquaculture. Traditional bacterin vaccines have had limited success in preventing furunculosis outbreaks . Subunit vaccines, which use specific protein antigens to stimulate an immune response, offer a promising alternative.

One study tested the efficacy of experimental subunit vaccines against A. salmonicida infection in rainbow trout. Researchers identified potential protective protein antigens through in silico screening of the A. salmonicida proteome. A total of 14 proteins were recombinantly expressed in Escherichia coli and prepared in 3 different subunit vaccine combinations to immunize rainbow trout .

The results showed that fish immunized with the subunit vaccines exhibited significantly lower mortalities (17-30%) compared to the control groups (48% and 56%). The enzyme-linked immunosorbent assay (ELISA) results revealed significantly elevated antibody levels in fish against several protein antigens, which in some cases were positively correlated to the survival .

Examples of Recombinant atpF proteins from other species

ProteinOrganism
Recombinant Full Length ATP synthase subunit b(atpF) Protein, His-TaggedLeptospira biflexa
Recombinant Full Length ATP synthase subunit b(atpF) Protein, His-TaggedBacillus pumilus
Recombinant Aeromonas Salmonicida atpF Protein (aa 1-156)Aeromonas Salmonicida

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ASA_4354; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Aeromonas salmonicida (strain A449)
Target Names
atpF
Target Protein Sequence
MSINATLLGQTLAFIIFVWCCMKFVWPPLMAAIEARQKAIADGLSSAERAKKDLDLAKAN ATDQLKEAKLQAAQIIEQANKRKAQIIDEAAVGAHTEREKILAQGRAEIDAERHRAKEEL RKQVAALAIAGAEKILARHIDQAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Aeromonas salmonicida and what is its function?

ATP synthase subunit b (atpF) is a component of the F0 domain of the bacterial ATP synthase complex in Aeromonas salmonicida. This protein functions as part of the membrane-embedded portion of the ATP synthase, contributing to the formation of the proton channel and serving as a peripheral stalk that connects the F1 and F0 domains. The ATP synthase complex is essential for cellular energy metabolism, coupling the electrochemical gradient across the bacterial membrane to the synthesis of ATP . In A. salmonicida, the atpF protein has been identified as a 19 kDa protein that may show differential expression under various environmental conditions, particularly in response to iron availability .

How is the atpF gene organized in the A. salmonicida genome?

The atpF gene in A. salmonicida is part of the ATP synthase operon located on the bacterial chromosome, which spans 4,702,402 bp and encodes 4,388 genes . The ATP synthase genes are typically organized in a conserved operon structure containing eight genes (atpBEFHAGDC). The atpF gene specifically encodes the b subunit of the F0 sector of ATP synthase. Within the A. salmonicida genome, this gene is maintained as part of the essential cellular machinery, despite the significant genomic rearrangements that have occurred during the evolution and host adaptation of this pathogen .

What methods are commonly used to clone and express recombinant A. salmonicida atpF?

Researchers typically employ the following methodological approach for cloning and expressing recombinant A. salmonicida atpF:

  • Gene amplification: PCR amplification of the atpF gene from A. salmonicida genomic DNA using specific primers designed based on the published genome sequence .

  • Cloning procedure:

    • Insertion of the amplified gene into an appropriate expression vector (commonly pET series vectors)

    • Transformation into a cloning strain (typically E. coli DH5α)

    • Verification of the construct by restriction digestion and sequencing

  • Protein expression:

    • Transformation of the verified construct into an expression host (commonly E. coli BL21(DE3))

    • Induction of protein expression using IPTG at optimized concentrations (typically 0.5-1 mM)

    • Growth at lower temperatures (16-25°C) may be necessary to improve solubility

  • Protein purification:

    • Lysis of cells using sonication or pressure-based methods

    • Purification by affinity chromatography (His-tag methods are commonly employed)

    • Further purification by ion-exchange or size exclusion chromatography if needed

Protein expression conditions often require optimization, as membrane-associated proteins like ATP synthase components can present challenges for recombinant expression .

How can researchers effectively study atpF expression under different environmental conditions?

To investigate atpF expression under varying environmental conditions, researchers can employ a multi-faceted approach:

  • Transcriptional analysis:

    • Real-time quantitative PCR (RT-qPCR) to measure atpF mRNA levels, as demonstrated in studies of A. salmonicida under iron-limited conditions

    • RNA-seq for genome-wide transcriptional profiling

    • Northern blotting for verification of specific transcript sizes

  • Protein expression analysis:

    • Western blotting with anti-AtpF antibodies

    • SDS-PAGE coupled with mass spectrometry for protein identification, which has previously identified AtpF as differentially expressed under iron-deprived conditions

    • 2D gel electrophoresis for more detailed protein separation

  • Environmental variables to test:

    • Iron availability (using chelators like 2'2-dipyridyl)

    • Temperature variations (relevant to host and environmental conditions)

    • pH changes

    • Oxygen levels

    • Growth phase (exponential vs. stationary)

    • Exposure to host factors or antimicrobial compounds

  • Data analysis:

    • Statistical analysis of replicate experiments

    • Correlation of atpF expression with other genes/proteins

    • Integration with physiological measurements (e.g., ATP production, growth rates)

For example, previous research has shown that AtpF appeared fainter on SDS-PAGE in the avirulent ATCC 33658 T isolate when cultivated under iron-deprived conditions, with qPCR revealing a minor up-regulation at the transcription level (2.50E+01, ranging from 1.32E+01 to 4.73E+01) .

What are the optimal conditions for purifying functional recombinant AtpF protein?

The following methodological approach is recommended for purifying functional recombinant AtpF:

  • Expression optimization:

    • Test multiple expression strains (BL21(DE3), C41(DE3), C43(DE3) - the latter two being optimized for membrane protein expression)

    • Vary induction conditions (IPTG concentration: 0.1-1.0 mM)

    • Test expression temperatures (16°C, 25°C, 30°C, 37°C)

    • Duration of expression (4h vs. overnight)

  • Cell lysis considerations:

    • Use gentle detergents (n-dodecyl β-D-maltoside, CHAPS, or digitonin) to solubilize membrane-associated AtpF

    • Include protease inhibitors to prevent degradation

    • Maintain appropriate buffer conditions (typically pH 7.5-8.0 with 100-300 mM NaCl)

  • Purification strategy:

    • Initial capture using affinity chromatography (Ni-NTA for His-tagged protein)

    • Intermediate purification using ion-exchange chromatography

    • Final polishing using size-exclusion chromatography

    • Consider using on-column refolding techniques if the protein forms inclusion bodies

  • Quality control assessments:

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to confirm monodispersity

    • Activity assays to verify functional state

    • Mass spectrometry to confirm protein identity and integrity

Maintaining the native structure of AtpF can be challenging as it is part of a multi-subunit membrane protein complex. Some researchers opt to co-express multiple ATP synthase subunits to improve stability and functionality of the recombinant proteins .

How can differential expression of atpF between virulent and avirulent strains be quantified?

Researchers can quantify differential expression of atpF between virulent and avirulent A. salmonicida strains using the following methodological approaches:

  • Strain selection and validation:

    • Choose well-characterized virulent strains (e.g., clinical isolates A-14390 and A-15233) and avirulent strains (e.g., ATCC 33658 T)

    • Verify virulence phenotypes through in vivo challenges or established in vitro assays

    • Ensure genetic characterization of all strains used

  • Expression analysis techniques:

    • RT-qPCR: Design primers specific to atpF with appropriate reference genes for normalization

    • Proteomics: Use label-free quantification or isotope labeling methods (iTRAQ, SILAC) coupled with mass spectrometry

    • Western blotting: Develop specific antibodies against AtpF for immunodetection

  • Experimental design considerations:

    • Standardize growth conditions (media, temperature, growth phase)

    • Include technical and biological replicates (minimum triplicate)

    • Test under multiple environmental conditions relevant to pathogenesis

    • Include time-course analyses to capture dynamic expression changes

  • Data analysis framework:

    • Calculate fold changes using appropriate statistical methods (2^-ΔΔCT method for qPCR)

    • Perform statistical tests to determine significance (t-test, ANOVA)

    • Normalize protein expression data to total protein or housekeeping proteins

    • Correlate expression levels with virulence phenotypes

Strain TypeTypical atpF Expression PatternResponse to Iron LimitationStatistical Significance
Virulent isolates (e.g., A-14390, A-15233)Baseline expression levelMinor upregulation (2.50E+01 fold change)p < 0.05
Avirulent isolate (ATCC 33658 T)Typically lower expressionDecreased protein levels observed on SDS-PAGEp < 0.05

Previous research with A. salmonicida has shown that proteins may exhibit different expression patterns between virulent and avirulent strains, and these differences can be further modulated by environmental conditions such as iron availability .

How does atpF expression coordinate with other virulence factors in A. salmonicida?

The coordination of atpF expression with other virulence factors in A. salmonicida represents a complex regulatory network that can be analyzed through the following methodological approaches:

  • Transcriptomic co-expression analysis:

    • RNA-seq analysis under conditions that induce virulence factor expression

    • Identification of co-regulated gene clusters containing atpF and known virulence factors

    • Construction of gene regulatory networks using algorithms such as WGCNA (Weighted Gene Co-expression Network Analysis)

  • Protein-protein interaction studies:

    • Pull-down assays using tagged AtpF to identify interacting partners

    • Bacterial two-hybrid systems to verify specific interactions

    • Cross-linking mass spectrometry to capture transient interactions

  • Regulatory mechanism investigations:

    • ChIP-seq to identify transcription factors binding to the atpF promoter region

    • Analysis of the role of histone-like nucleoid structuring protein (H-NS), which is known to be differentially expressed under iron-limited conditions that also affect atpF expression

    • Investigation of quorum sensing effects on atpF expression, as A. salmonicida virulence is known to be regulated by quorum sensing systems

  • Metabolic context analysis:

    • Measurement of ATP levels and membrane potential in wild-type and atpF mutant strains

    • Analysis of how energy metabolism interfaces with virulence factor secretion systems, particularly the Type III Secretion System (T3SS)

Research has shown that in A. salmonicida, the expression of some virulence factors like T3SS decreases significantly from exponential to stationary phase, while the expression of other virulence factors (proteases, lipases, chitinases) increases . Understanding how atpF expression correlates with these patterns could provide insights into its role in virulence regulation .

What structural and functional adaptations distinguish A. salmonicida AtpF from homologs in other bacterial species?

The structural and functional adaptations of A. salmonicida AtpF can be investigated through these methodological approaches:

  • Comparative sequence analysis:

    • Multiple sequence alignment of atpF genes from A. salmonicida, A. hydrophila, and other related species

    • Identification of conserved domains versus variable regions

    • Phylogenetic analysis to trace evolutionary relationships

  • Structural biology techniques:

    • X-ray crystallography or cryo-electron microscopy of purified recombinant AtpF

    • Homology modeling based on solved structures from related species

    • Molecular dynamics simulations to predict functional movements and interactions

  • Functional domain mapping:

    • Site-directed mutagenesis of key residues identified through comparative analysis

    • Chimeric protein construction swapping domains between A. salmonicida AtpF and homologs

    • Assessment of function through complementation studies in atpF knockout strains

  • Host adaptation analysis:

    • Investigation of temperature-dependent structural stability relevant to fish host environments

    • Analysis of protein modifications that may occur under host conditions

    • Comparative assessment of ATP synthase activity at temperatures relevant to fish pathogens versus other bacteria

A. salmonicida has undergone substantial genomic rearrangements compared to related species like A. hydrophila, with approximately 9% difference in gene content and the development of numerous pseudogenes as a consequence of adaptation to salmonid hosts . It would be valuable to determine whether atpF has undergone specific adaptations related to this host specialization or whether it remains highly conserved due to its essential metabolic function .

How does post-translational modification affect AtpF function in different growth conditions?

Investigating post-translational modifications (PTMs) of AtpF requires sophisticated methodological approaches:

  • PTM identification techniques:

    • Mass spectrometry-based proteomics with enrichment for specific modifications:

      • Phosphorylation (TiO2 chromatography, phospho-antibodies)

      • Acetylation (anti-acetyllysine antibodies)

      • Oxidative modifications (biotin-hydrazide labeling)

    • Top-down proteomics to maintain intact proteins with their modifications

    • Multiple reaction monitoring (MRM) for targeted quantification of specific modified peptides

  • Growth condition variations:

    • Iron-limited versus iron-replete media

    • Aerobic versus anaerobic conditions

    • Different carbon sources and metabolic states

    • Exposure to host immune factors or antimicrobial compounds

    • Temperature and pH variations relevant to host environment

  • Functional impact assessment:

    • Site-directed mutagenesis to mimic or prevent specific modifications

    • ATP synthase activity assays under different conditions

    • Membrane potential measurements using fluorescent probes

    • Growth rate and fitness measurements of strains with mutated modification sites

  • Regulatory enzyme identification:

    • Kinase/phosphatase inhibitor studies

    • Co-immunoprecipitation to identify enzymes that interact with AtpF

    • Genetic screens for regulators affecting AtpF modification state

Previous research has shown that A. salmonicida proteins can exhibit differential expression under varying environmental conditions, particularly iron limitation . The histone-like nucleoid structuring protein (H-NS) is significantly overexpressed under iron-replete conditions (average transcription ratios of 1.89E+03) , suggesting complex regulatory mechanisms that may also involve post-translational control of metabolic enzymes like ATP synthase.

How should researchers interpret discrepancies between transcriptional and translational expression data for atpF?

Researchers encountering discrepancies between atpF mRNA and protein levels should use the following methodological framework for interpretation:

  • Validation of discrepancies:

    • Confirm findings using alternative methods:

      • For transcriptional data: Validate RT-qPCR with RNA-seq or Northern blotting

      • For protein data: Verify Western blot results with mass spectrometry quantification

    • Ensure proper normalization methods are applied for both datasets

    • Check for technical biases in sample preparation or analysis

  • Biological mechanisms exploration:

    • Investigate post-transcriptional regulation:

      • mRNA stability (half-life measurements)

      • Small RNA regulation (identify potential sRNA binding sites in atpF mRNA)

      • RNA-binding protein interactions

    • Assess translational efficiency:

      • Ribosome profiling to measure translation rates

      • Analysis of codon usage and optimization

    • Examine protein turnover:

      • Pulse-chase experiments to determine protein half-life

      • Protease activity and specificity in different conditions

  • Temporal considerations:

    • Perform time-course experiments to detect delays between transcription and translation

    • Consider growth phase-specific effects on gene expression and protein accumulation

  • Statistical analysis framework:

    • Apply appropriate statistical models for time-series data

    • Calculate correlation coefficients between mRNA and protein levels across conditions

    • Implement regression analysis to identify factors explaining the variance

This approach is particularly relevant for atpF in A. salmonicida, as previous research has shown that while the protein appeared to be less expressed under iron-deprived conditions when analyzed by SDS-PAGE, qPCR analysis indicated a minor up-regulation at the transcription level . Such discrepancies highlight the complexity of gene expression regulation and the importance of multi-level analysis.

What genomic and experimental factors explain variability in atpF expression across different A. salmonicida isolates?

The variability in atpF expression across different A. salmonicida isolates can be explained through systematic analysis of genomic and experimental factors:

  • Genomic variation analysis:

    • Whole genome sequencing of multiple isolates to identify:

      • Single nucleotide polymorphisms in the atpF gene and its promoter

      • Structural variations affecting the ATP synthase operon

      • Differences in regulatory elements affecting atpF expression

    • Targeted sequencing of the atpF locus in a larger collection of isolates

    • Analysis of mobile genetic elements that may affect genome organization

  • Regulatory network characterization:

    • Comparative transcriptomics to identify differences in regulatory pathways

    • Analysis of transcription factor binding sites in atpF promoter regions

    • Investigation of strain-specific regulatory mechanisms

  • Strain background effects:

    • Analysis of virulence characteristics (virulent vs. avirulent strains)

    • Assessment of pseudogene accumulation in different isolates

    • Measurement of growth rates and metabolic profiles

  • Experimental design considerations:

    • Standardization of growth conditions across experiments

    • Control for growth phase effects on expression

    • Account for the activation state of virulence systems like T3SS

Strain CategoryGenomic FeaturesTypical atpF Expression CharacteristicsKey Influencing Factors
Virulent clinical isolatesComplete virulence plasmidsHigher baseline expressionIntact T3SS, fewer pseudogenes
Laboratory-adapted strainsPossible plasmid lossVariable expressionAccumulation of mutations, stress adaptation
Avirulent strainsPotential pseudogenesGenerally lower expressionT3SS mutations, regulatory differences

The A. salmonicida genome contains 170 pseudogenes and 88 insertion sequences, with genetic variations that can significantly affect gene expression patterns . Additionally, cultivation conditions can lead to genetic rearrangements, particularly involving the large plasmids that carry virulence factors .

How can researchers distinguish between direct and indirect effects on atpF expression in genetic knockout studies?

To distinguish between direct and indirect effects on atpF expression in genetic knockout studies, researchers should implement this methodological framework:

  • Experimental design strategies:

    • Generate precise gene knockouts using CRISPR-Cas9 or allelic exchange methods

    • Create conditional knockouts (inducible systems) to control the timing of gene inactivation

    • Construct complementation strains to verify phenotype restoration

    • Develop point mutations in regulatory regions rather than complete gene deletions

  • Molecular analysis techniques:

    • Direct regulatory interactions:

      • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding to atpF promoter

      • Electrophoretic mobility shift assays (EMSA) to verify specific DNA-protein interactions

      • Reporter gene assays using atpF promoter constructs

    • Indirect effects assessment:

      • Global transcriptomics (RNA-seq) to identify cascade effects

      • Metabolomics to detect changes in cellular metabolism affecting ATP synthase regulation

      • Protein-protein interaction studies to map the regulatory network

  • Temporal resolution approaches:

    • Time-course experiments following gene knockout induction

    • Pulse-chase labeling to track newly synthesized proteins

    • Single-cell analysis to capture cell-to-cell variability and expression dynamics

  • Statistical and computational analysis:

    • Network analysis to map direct and indirect regulatory pathways

    • Causal inference modeling to distinguish primary from secondary effects

    • Integration of multi-omics data to build comprehensive regulatory models

This approach is particularly important when studying genes like those encoding the histone-like nucleoid structuring protein (H-NS), which has been shown to be differentially expressed under iron-limited conditions and may act as a global regulator affecting multiple genes including atpF . Similarly, when investigating the relationship between energy metabolism (ATP synthase function) and virulence factor expression, distinguishing direct regulatory links from metabolic consequences is critical .

What are the prospects for targeting atpF in vaccine development against A. salmonicida infections?

The potential for targeting atpF in vaccine development against A. salmonicida infections can be evaluated through the following methodological approaches:

  • Antigen evaluation framework:

    • Assess conservation of AtpF sequence across A. salmonicida strains

    • Identify immunogenic epitopes using in silico prediction tools and experimental validation

    • Evaluate surface accessibility of AtpF epitopes in intact bacteria

    • Test recombinant AtpF protein for immunogenicity in fish models

  • Vaccine formulation strategies:

    • Develop subunit vaccines using purified recombinant AtpF

    • Design DNA vaccines encoding the atpF gene

    • Create attenuated live vaccines with enhanced atpF expression

    • Formulate multivalent vaccines combining AtpF with other virulence factors

  • Delivery system optimization:

    • Test various adjuvants suitable for fish vaccination

    • Develop oral delivery methods using encapsulation technologies

    • Optimize immersion vaccination protocols

    • Evaluate prime-boost strategies combining different delivery methods

  • Efficacy assessment methodology:

    • Measure antibody responses in vaccinated fish

    • Analyze T-cell responses to AtpF epitopes

    • Conduct challenge studies with virulent A. salmonicida strains

    • Evaluate cross-protection against different subspecies and isolates

Studies have shown that resistance to A. salmonicida is moderately heritable with oligogenic architecture , suggesting that targeted vaccination approaches could be effective. The identification of quantitative trait loci (QTL) associated with resistance, as reported on chromosome 16 , could inform vaccine development strategies that complement natural resistance mechanisms.

How might CRISPR-Cas9 gene editing be optimized for studying atpF function in A. salmonicida?

CRISPR-Cas9 gene editing for studying atpF function in A. salmonicida requires specific methodological considerations:

  • CRISPR system adaptation for A. salmonicida:

    • Optimize codon usage of Cas9 for expression in A. salmonicida

    • Develop species-specific promoters for guide RNA expression

    • Test various delivery methods (electroporation, conjugation, transduction)

    • Evaluate different Cas9 variants (SpCas9, SaCas9, Cas12a) for efficiency

  • Guide RNA design strategies:

    • Conduct genome-wide specificity analysis to minimize off-target effects

    • Design multiple guide RNAs targeting different regions of the atpF gene

    • Create guide RNAs for precise point mutations versus complete gene knockout

    • Develop multiplex CRISPR systems for simultaneous editing of atpF and related genes

  • Genetic modification approaches:

    • Gene knockout: Complete deletion or functional inactivation of atpF

      • Design homology-directed repair templates with antibiotic resistance markers

      • Create scarless deletions using counter-selection methods

    • Specific mutations: Introduction of point mutations in functional domains

      • Design precise repair templates with desired mutations

      • Include silent mutations to prevent re-cutting

    • Tagging strategies: Fusion of reporter proteins or affinity tags

      • Design in-frame fusions that maintain protein function

      • Create conditional degradation systems

  • Phenotypic analysis framework:

    • Growth assays under various conditions (temperature, pH, nutrient availability)

    • ATP production measurements

    • Membrane potential assessment

    • Virulence factor expression and secretion analysis

    • In vivo infection models to assess virulence

The A. salmonicida genome contains numerous insertion sequences and mobile genetic elements , which may complicate CRISPR-Cas9 editing by providing sites for unwanted recombination. Additionally, the essential nature of ATP synthase for cellular viability necessitates careful design of conditional or partial loss-of-function mutations when studying atpF.

How can systems biology approaches integrate atpF function with global metabolic networks in A. salmonicida pathogenesis?

Systems biology approaches for integrating atpF function with global metabolic networks require sophisticated methodological frameworks:

  • Multi-omics data generation and integration:

    • Genome-scale metabolic model construction for A. salmonicida

    • Transcriptomics under various infection-relevant conditions

    • Proteomics focused on metabolic enzyme abundance and modifications

    • Metabolomics to track metabolic fluxes and energy currency molecules

    • Fluxomics using labeled substrates to measure actual metabolic pathway activities

  • Network analysis methodologies:

    • Constraint-based modeling (flux balance analysis) to predict metabolic states

    • Regulatory network reconstruction incorporating transcription factors and small RNAs

    • Protein-protein interaction networks including ATP synthase subunits

    • Signal transduction pathway mapping linked to metabolic regulation

  • Perturbation experiments design:

    • Controlled modulation of atpF expression using inducible systems

    • Environmental challenges mimicking host conditions:

      • Iron limitation

      • Oxidative stress

      • Temperature shifts

      • Antimicrobial exposure

    • Genetic perturbations of related pathways

  • Computational modeling frameworks:

    • Ordinary differential equation models of core metabolic processes

    • Agent-based models of bacterial populations during infection

    • Machine learning approaches to identify emergent properties

    • Integration of host-pathogen interaction data

Data TypeRelevant ParametersIntegration Points with atpFAnalytical Methods
GenomicGene presence/absence, SNPsGenetic context of ATP synthase operonComparative genomics, variant calling
TranscriptomicGene expression patternsCo-expression with virulence factorsDifferential expression, network analysis
ProteomicProtein abundance, PTMsATP synthase complex assemblyProtein-protein interactions, complex analysis
MetabolomicATP/ADP ratios, PMFEnergy currency availabilityFlux balance analysis, metabolic control analysis

By integrating data on ATP synthase function with global metabolic networks, researchers can better understand how energy metabolism interfaces with virulence mechanisms in A. salmonicida, potentially revealing new therapeutic targets. The known relationship between iron availability and differential expression of proteins like AtpF provides a starting point for these systems-level investigations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.