Recombinant Aeromonas salmonicida Na (+)-translocating NADH-quinone reductase subunit E

What is Aeromonas salmonicida Na(+)-translocating NADH-quinone reductase subunit E and what is its function?

The Na(+)-translocating NADH:quinone oxidoreductase (Na+-NQR) is a unique respiratory enzyme that catalyzes electron transfer from NADH to quinone coupled with sodium ion translocation across bacterial membranes. Subunit E (NqrE) is one of six subunits (NqrA-F) comprising this complex. In Aeromonas salmonicida, this enzyme plays a critical role in energy metabolism by maintaining sodium gradients across cell membranes .

According to protein databases, the NqrE subunit consists of 198 amino acids with the sequence: "MEHYLSLLIRSIFIENLALSFFLGMCTFLAVSKKVKTAMGLGIAVIVVQTVAVPANNLIYNYVLKDGVLVSGLDLSFLSFITFIGVIAALVQILEMALDKYFPALYNALGIFLPLITVNCAIFGGVSFMVQRDYNFVESVVYGVGSGAGWMLAIVAMAIRKKKMKYSDVPQGLRGLGITFITAGLMALGFMSFSGISL" . The protein contains multiple transmembrane domains and contributes to both electron transport and sodium pumping activities of the Na+-NQR complex.

How does Na+-NQR differ from other respiratory enzymes like Complex I?

Na+-NQR fundamentally differs from the proton-pumping NADH:ubiquinone oxidoreductase (Complex I) despite catalyzing similar redox reactions. Key differences include:

• Ion specificity: Na+-NQR couples electron transfer to sodium ion translocation rather than proton pumping .

• Structural organization: While Complex I has a characteristic L-shaped structure with 14+ subunits, Na+-NQR consists of just six subunits (NqrA-F) with different cofactor composition .

• Cofactor content: Na+-NQR contains a non-covalently bound FAD, two covalently bound FMN molecules, a 2Fe-2S center, and riboflavin, forming a unique electron transfer pathway .

• Taxonomic distribution: Typically, Vibrio species and Aeromonas salmonicida possess Na+-NQR but lack Complex I, suggesting Na+-NQR's significant contribution to bacterial physiology in these organisms .

The physiological significance of these differences lies in adaptation to different environments. Na+-based bioenergetics is particularly advantageous in alkaline or high-salt environments where maintaining a proton gradient would be energetically expensive.

What expression systems are most effective for producing recombinant Aeromonas salmonicida NqrE?

Based on the literature, the following expression systems have proven most effective for producing recombinant Aeromonas salmonicida NqrE:

For optimal expression of NqrE, which is a membrane protein, the following conditions are recommended:

• Growth temperature: 16-25°C after induction to improve proper folding

• Induction: 0.1-0.5 mM IPTG for extended periods (overnight)

• Media: Rich media (e.g., Terrific Broth) supplemented with 5-10% glycerol to help with membrane protein folding

Commercial preparations typically use E. coli as the expression host, with the protein fused to an N-terminal His-tag to facilitate purification .

What purification strategies maintain the structural and functional integrity of recombinant NqrE?

Purification of recombinant NqrE requires specialized approaches to maintain its structural integrity as a membrane protein:

• Membrane extraction: After cell disruption, membrane fractions should be isolated by differential centrifugation (typically 100,000 × g for 1 hour).

• Detergent solubilization: Mild detergents like n-dodecyl β-D-maltoside (DDM) at 1-2% concentration are recommended for Na+-NQR subunits. Solubilization should occur at 4°C for 1-2 hours with gentle agitation.

• Affinity chromatography: If the protein has a His-tag as mentioned in commercial preparations , nickel or cobalt affinity resins can be used with buffers containing low detergent concentrations (0.05-0.1% DDM).

• Size exclusion chromatography: This final polishing step improves purity and removes aggregates. Buffers typically contain 150-300 mM NaCl, 20-50 mM Tris or phosphate buffer (pH 7.5-8.0), and low detergent concentration.

Throughout purification, maintaining cold temperature (4°C) and including protease inhibitors prevents degradation. The purity of recombinant NqrE should be assessed by SDS-PAGE, with commercial preparations typically achieving >85% purity .

What approaches can overcome inclusion body formation when expressing NqrE in E. coli?

Inclusion body formation is a common challenge when expressing membrane proteins like NqrE in E. coli. Several strategies can mitigate this issue:

• Strain selection: Specialized strains like ArcticExpress (DE3) promote proper folding at low temperatures through active molecular chaperones .

• Expression conditions:

  • Lower growth temperature (16-20°C) post-induction

  • Reduced inducer concentration (0.1-0.2 mM IPTG)

  • Slower induction using auto-induction media

• Genetic approaches:

  • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Fusion with solubility-enhancing tags (MBP, SUMO, TrxA)

  • Codon optimization for E. coli expression

• Reconstitution approaches:

  • If inclusion bodies persist, consider refolding protocols with gradual detergent introduction

  • Solubilization in strong detergents followed by exchange to milder ones

  • Addition of specific lipids that might stabilize the protein structure

According to analysis of recombinant enzyme expression in E. coli, there is no standardized method for promoting solubility, with researchers employing disparate practices. A systematic approach combining bioinformatics, modeling, and systems-level analysis is recommended for difficult-to-express proteins like membrane-bound NqrE .

What spectroscopic methods best characterize the redox properties of recombinant Na+-NQR components?

Several spectroscopic methods are particularly valuable for studying the redox properties of Na+-NQR components:

• Electron Paramagnetic Resonance (EPR) Spectroscopy: Highly effective for detecting organic radicals formed during electron transfer, such as ubisemiquinones generated by Na+-NQR. This technique can directly observe paramagnetic species including flavin semiquinones and iron-sulfur clusters in their reduced states .

• UV-Visible Absorption Spectroscopy: Allows monitoring of the redox state of flavin cofactors, which exhibit characteristic absorption changes upon reduction or oxidation.

• Stopped-flow Spectroscopy: Essential for resolving the rapid electron transfer events within the Na+-NQR complex. This approach has been instrumental in determining the sequence of electron transfer and identifying which redox steps couple to sodium ion translocation .

• Fluorescence Spectroscopy: Since Na+-NQR contains flavin cofactors that are naturally fluorescent, this technique provides information about cofactor environment and redox state changes.

When studying recombinant NqrE specifically, it's important to note that while individual subunits may be expressed recombinantly, the complete electron transfer pathway exists only in the intact complex. Therefore, reconstitution experiments combining purified subunits may be necessary for comprehensive redox characterization.

How can the sodium translocation activity of Na+-NQR be measured experimentally?

Measuring sodium translocation by Na+-NQR requires specialized techniques that detect sodium ion movement across membranes:

• Sodium ion-selective electrodes: These directly measure changes in sodium concentration in reaction mixtures. For reconstituted Na+-NQR in proteoliposomes, external sodium concentration can be monitored to detect sodium pumping activity upon addition of NADH.

• Isotope flux assays: Using radioactive 22Na+ to trace sodium movement across membranes provides high sensitivity for unidirectional flux measurements.

• Membrane potential measurements: Since Na+ translocation generates an electrical potential, voltage-sensitive dyes like oxonol VI or DiSC3(5) can indirectly monitor Na+-NQR activity by detecting membrane potential changes.

Research indicates that Na+ uptake by Na+-NQR is a nonelectrogenic process occurring upon electron transfer from the 2Fe-2S center to FMN C, while the electrogenic transport of Na+ occurs upon electron transfer from FMN B to riboflavin . This knowledge informs experimental design for measuring specific steps in the sodium translocation process.

Functional reconstitution typically involves incorporating purified Na+-NQR complex into liposomes with controlled internal and external buffer compositions. Activity measurements should include controls such as specific inhibitors of Na+-NQR or ionophores that collapse the sodium gradient.

What experimental evidence links specific redox centers in Na+-NQR to sodium translocation steps?

Research has established specific connections between redox centers and sodium translocation in Na+-NQR:

• Sodium uptake mechanism: Studies using stopped-flow spectroscopy have demonstrated that sodium uptake is coupled to electron transfer from the 2Fe-2S center to FMN C. This is a nonelectrogenic process, suggesting sodium binding without membrane translocation at this stage .

• Electrogenic sodium transport: The electrogenic (membrane potential-generating) step occurs during electron transfer from FMN B to riboflavin. This represents the actual translocation of sodium across the membrane .

• Mutational evidence: Mutations affecting specific residues provide crucial insights:

  • NqrB-D397A mutation decreases apparent affinity for sodium by orders of magnitude, affecting sodium binding

  • NqrB-G140A mutation blocks sodium ejection while maintaining sodium binding affinity

• Kinetic studies: The rate of reduction of FMN C is altered in sodium-binding mutants, while electron transfer to riboflavin is affected in sodium-ejection mutants .

These findings support a model where Na+-NQR operates through conformationally mediated, kinetically coupled mechanisms rather than direct redox-dependent changes in sodium affinity, representing a distinct family of redox-driven ion pumps .

How does environmental sodium concentration affect Na+-NQR activity and bacterial physiology?

Environmental sodium concentration significantly impacts Na+-NQR activity and bacterial physiology through several mechanisms:

These findings suggest that sodium concentration in the bacterial environment not only affects Na+-NQR activity directly but also influences broader aspects of bacterial physiology through altered redox state, ROS production, and metabolic regulation.

What role might Na+-NQR play in the pathogenicity of Aeromonas salmonicida?

Na+-NQR may contribute to the pathogenicity of Aeromonas salmonicida through several mechanisms:

• Energy metabolism and adaptation: Na+-NQR provides a primary means of respiratory energy conservation that may support growth and persistence in host environments. Deletion of the nqr operon in related bacteria results in multiple metabolic defects, suggesting its importance for bacterial fitness .

• Adaptation to host ionic environments: A. salmonicida must adapt to changing ionic conditions during infection. The sodium-pumping activity of Na+-NQR may help maintain ionic homeostasis in these environments.

• Oxidative stress generation: Na+-NQR activity generates reactive oxygen species (ROS) during respiration, with rates increasing in response to environmental sodium concentration . These ROS might contribute to host tissue damage during infection.

• Virulence regulation: A. salmonicida possesses various virulence factors, including the Type Three Secretion System (T3SS) described as a major virulence system . While direct interactions between Na+-NQR and these virulence systems haven't been established, the metabolic support provided by Na+-NQR may influence virulence factor expression.

A. salmonicida causes furunculosis in salmonid fish with significant economic impact in aquaculture . Understanding Na+-NQR's role in pathogenicity could potentially inform novel therapeutic approaches targeting this enzyme complex.

How can site-directed mutagenesis of NqrE advance understanding of sodium transport mechanisms?

Site-directed mutagenesis of NqrE provides critical insights into Na+-NQR sodium transport mechanisms:

• Identification of sodium-binding residues: Mutagenesis of conserved polar or charged residues in transmembrane domains can identify those involved in sodium coordination. Key targets include conserved aspartate, glutamate, serine, or threonine residues in membrane-spanning regions.

• Probing transmembrane channels: NqrE likely contributes to forming a transmembrane channel for sodium movement. Systematic mutation of residues along potential channel pathways can map this structure.

• Investigating subunit interactions: Mutations at interfaces between NqrE and other subunits can reveal how conformational changes transmit through the complex during catalysis.

Examples from related research show the power of this approach:

• Mutations in NqrB (D397A) decreased apparent sodium affinity by orders of magnitude, identifying a critical sodium binding site

• Mutations in NqrB (G140A) blocked sodium ejection while maintaining sodium binding affinity

These experiments should include:

• Complementation assays in Na+-NQR-deficient strains

• Enzyme kinetic studies measuring changes in sodium dependence

• Direct sodium transport measurements in reconstituted systems

• Structural studies to visualize mutation-induced changes

Such systematic mutagenesis can identify residues specifically involved in sodium coordination, channel formation, or conformational coupling that are essential to the sodium transport mechanism.

What are common obstacles in functional reconstitution of Na+-NQR components?

Functional reconstitution of Na+-NQR components presents several technical challenges:

• Incomplete cofactor incorporation: Na+-NQR contains multiple cofactors (FAD, FMN, 2Fe-2S, riboflavin) that must be correctly incorporated for function.

  • Solution: Supplement expression media with riboflavin and iron sources; for in vitro reconstitution, incubate purified proteins with excess cofactors under suitable redox conditions

• Improper subunit assembly: The six subunits must correctly assemble for function.

  • Solution: Co-express multiple subunits using polycistronic constructs or compatible plasmids; alternatively, purify individual subunits and reconstitute the complex using controlled detergent-lipid mixtures

• Protein instability outside the native membrane:

  • Solution: Identify stabilizing conditions through thermal shift assays testing various detergents, lipids, and buffer components; consider nanodiscs or amphipols as alternatives to detergent

• Inefficient proteoliposome reconstitution:

  • Solution: Optimize lipid composition to mimic the native membrane; control protein-to-lipid ratios carefully; use gradual detergent removal methods

• Loss of activity due to oxidative damage:

  • Solution: Maintain anaerobic conditions during purification and reconstitution when possible; include reducing agents

A systematic approach combining bioinformatics, modeling, and experimental optimization can help overcome these challenges .

How can researchers distinguish between effects on sodium binding versus electron transfer in Na+-NQR mutants?

Differentiating between effects on sodium binding versus electron transfer in Na+-NQR mutants requires a multi-faceted approach:

• Spectroscopic analysis of electron transfer:

  • Use stopped-flow spectroscopy to measure rates of electron transfer between redox centers

  • Monitor reduction/oxidation of specific cofactors using UV-Vis spectroscopy

  • Compare kinetics in the presence and absence of sodium to identify sodium-dependent steps

• Sodium binding measurements:

  • Directly measure sodium binding using 23Na NMR or sodium-selective electrodes

  • Use fluorescent sodium indicators to monitor sodium movement

  • Conduct competitive binding studies with lithium or other cations

• Kinetic analysis:

  • Measure Km for sodium and compare with Km for electron donors/acceptors

  • Determine if mutations affect Vmax (catalytic efficiency) or only Km for sodium

Research on Na+-NQR mutants shows that some specifically affect sodium binding (NqrB-D397A) while others affect sodium ejection (NqrB-G140A) . A key experiment would be comparing rates of specific electron transfer steps in wild-type versus mutant proteins under varying sodium concentrations. If the mutation affects sodium binding directly, the sodium dependence curve would shift (changed Km) while maximum rates might remain similar. If the mutation affects electron transfer, the maximum rate would change regardless of sodium concentration.

What techniques can investigate Na+-NQR's role in Aeromonas salmonicida physiology and pathogenicity?

Several advanced techniques can elucidate Na+-NQR's role in A. salmonicida physiology and pathogenicity:

• Gene deletion and complementation:

  • Create clean nqr operon deletions in A. salmonicida

  • Complement with wild-type or mutant versions of the operon

  • Assess effects on growth, metabolism, and virulence in fish models

• Multi-omics approaches:

  • Transcriptomics: RNA-seq comparing wild-type and Δnqr mutant

  • Proteomics: Quantitative analysis of protein abundance changes

  • Metabolomics: Analysis of metabolic profiles affected by Na+-NQR function

  Similar approaches with Vibrio cholerae revealed that Na+-NQR affects multiple metabolic pathways, including sialic acid catabolism and lysine metabolism .

• Bioenergetic analysis:

  • Measure membrane potential and sodium gradients in wild-type versus mutant strains

  • Assess respiratory capacity under different growth conditions

  • Determine Na+-NQR's contribution to cellular energy production

• Infection models:

  • Analyze in vivo fitness of Na+-NQR mutants in fish models of furunculosis

  • Study Na+-NQR expression during different infection stages

  • Test if Na+-NQR inhibitors attenuate virulence

These approaches would provide valuable insights into the link between A. salmonicida's energy metabolism via Na+-NQR and its pathogenicity mechanisms, potentially informing new therapeutic strategies for controlling furunculosis in aquaculture .