Recombinant Aeromonas salmonicida NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Metabolism

nuoK contributes to the NADH dehydrogenase complex (Complex I), which catalyzes electron transfer from NADH to quinone, coupled with proton translocation across the membrane . This activity is critical for generating the proton motive force (PMF) required for ATP synthesis . In A. salmonicida, disruption of this complex could impair energy metabolism, potentially reducing virulence .

Genomic Context and Pathogenicity

A. salmonicida, a Gram-negative pathogen causing furunculosis in salmonids, encodes nuoK within its respiratory gene cluster. Recent genomic analyses of re-emergent strains in Chile and Germany revealed conserved sequences in nuoK across isolates, suggesting its role in metabolic adaptation and pathogen persistence .

Key Genomic Insights:

  • Conservation: nuoK exhibits <15 single-nucleotide polymorphisms (SNPs) compared to reference strains, indicating high stability .

  • Resistome Link: NADH dehydrogenase subunits are co-expressed with antibiotic resistance genes (sul1, tetA) in aquaculture-associated strains .

4.1. Superoxide Production and Virulence

In related bacteria (Vibrio cholerae), the NADH-quinone oxidoreductase generates reactive oxygen species (ROS) via FAD-mediated electron leakage, which modulates virulence gene expression . Although direct evidence in A. salmonicida is lacking, structural homology suggests nuoK may similarly influence oxidative stress responses and host adaptation .

4.2. Vaccine Development Potential

Closed genomes of A. salmonicida strains (e.g., Chilean isolates) have enabled epitope mapping of respiratory proteins like nuoK for autogenous vaccine design . These vaccines could target conserved regions to mitigate furunculosis outbreaks in aquaculture .

Supplier Information

The protein is commercially available as a lyophilized powder with His-tag purification:

SupplierCUSABIO TECHNOLOGY LLC
Catalog NumberRFL25989AF
Host SpeciesAeromonas salmonicida
Application NotesNot for human consumption; research use only

Source:

Future Directions

  • Mechanistic Studies: Elucidate nuoK’s role in ROS signaling and biofilm formation.

  • Antimicrobial Targets: Explore inhibition of NADH dehydrogenase to disrupt bacterial bioenergetics .

  • Vaccine Optimization: Validate nuoK-derived antigens in challenge trials using salmonid models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly equipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage condition, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; ASA_1727; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Aeromonas salmonicida (strain A449)
Target Names
nuoK
Target Protein Sequence
MNGIPMEHGLLLAAILFCIGLCGLLIRRNLLFILMSIEIMMNASALAFVVAGSRWAQADG QIMYILVISLAAAEASIGLALLLLLYRRYHTLNVDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is considered the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.