Recombinant Aeromonas salmonicida Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics and Identification

The Recombinant Aeromonas salmonicida Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE is a membrane protein classified in chemical databases with the specific identifier CB815628356 . This protein belongs to a class of membrane transporters known as flippases, which facilitate the translocation of lipid-linked substrates across cellular membranes. The specific function of this protein involves the movement of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol molecules across the bacterial membrane, a process critical for lipopolysaccharide (LPS) modification in many Gram-negative bacteria.

Commercial preparations of this recombinant protein are available through suppliers such as CUSABIO TECHNOLOGY LLC, indicating its relevance to current research applications . The protein is typically produced through recombinant expression systems, with options including production in E. coli, yeast, baculovirus, or mammalian cell expression systems . This flexibility in production methodologies allows researchers to select the most appropriate system for their specific experimental requirements.

Molecular Characterization

While the specific molecular weight of the native ArnE protein from Aeromonas salmonicida is not definitively established in the available literature, the protein is characterized as a membrane-embedded flippase component. The protein's nomenclature indicates its predicted function in flipping phosphoundecaprenol-linked substrates across the bacterial membrane, specifically those containing the modified arabinose component 4-amino-4-deoxy-L-arabinose.

Commercially available recombinant forms of this protein (product code VAng-Lsx1517) are prepared specifically for research applications, with documentation emphasizing that these preparations are strictly for research purposes and cannot be used directly on humans or animals . This restriction underscores the preliminary nature of research involving this protein and its current application primarily in basic science investigations.

Biological Context: Aeromonas salmonicida Pathogenesis

To understand the significance of the ArnE protein, it is essential to examine the biological context of Aeromonas salmonicida, the bacterium from which this protein originates. Aeromonas salmonicida is a Gram-negative, facultative anaerobic, rod-shaped bacterium belonging to the family Enterobacteriaceae . This pathogen is most notably recognized as the etiological agent of furunculosis, a severe septicemic disease affecting salmonids and other teleost species worldwide .

Disease Characteristics and Impact

Furunculosis manifests with distinctive clinical presentations, including characteristic skin lesions referred to as furuncles, ulcers, exophthalmia, hemorrhages, and systemic septicemia, often resulting in acute mortality in affected fish populations . The economic impact of this disease on aquaculture operations is substantial, making understanding the pathogenesis mechanisms of A. salmonicida a priority for developing effective control strategies.

The virulence of A. salmonicida is multifactorial, with several key pathogenic mechanisms identified. Among these, the Type III Secretion System (TTSS) represents one of the primary virulence factors . Research has demonstrated that expression of TTSS proteins in A. salmonicida is temperature-dependent, with induction occurring at 28°C but not at the bacterium's more natural growth temperature of 17°C . This temperature-induced up-regulation occurs rapidly, within 30 minutes of a growth temperature increase from 16°C to 28°C, suggesting sophisticated regulatory mechanisms controlling virulence factor expression.

Functional Significance of ArnE in Bacterial Physiology

The ArnE protein, as a probable flippase subunit involved in lipopolysaccharide modification, likely plays a significant role in bacterial adaptation to environmental stresses, particularly those related to antimicrobial exposure. In Gram-negative bacteria, modifications to the lipopolysaccharide layer often contribute to resistance against antimicrobial peptides and other host defense mechanisms.

Lipopolysaccharide Modification Pathway

The 4-amino-4-deoxy-L-arabinose modification of lipopolysaccharide represents a well-documented mechanism of resistance to cationic antimicrobial peptides in various Gram-negative bacteria. This modification reduces the negative charge of the bacterial outer membrane, thereby decreasing the electrostatic attraction of positively charged antimicrobial peptides to the bacterial surface.

Membrane Antigenic Properties

Recent research has identified significant antigenic differences among Aeromonas salmonicida isolates, with variations in outer membrane protein and lipopolysaccharide profiles suggesting profound changes at the membrane structure level . While these studies specifically focused on the VapA virulence factor rather than ArnE, they highlight the importance of membrane composition in bacterial pathogenesis and host immune response evasion. The ArnE protein, through its role in LPS modification, may contribute to these antigenic variations and consequently influence host-pathogen interactions.

Recombinant Production and Research Applications

The recombinant production of ArnE protein enables detailed investigation of its structure, function, and potential as a therapeutic target. As indicated in available commercial information, the protein can be produced in various expression systems, including E. coli, yeast, baculovirus, or mammalian cells . This versatility allows researchers to optimize production based on specific experimental requirements.

Expression Systems Comparison

The selection of an appropriate expression system for recombinant ArnE production depends on several factors, including desired yield, post-translational modifications, and functional requirements. Table 1 summarizes the comparative advantages of different expression systems for membrane protein production:

Expression SystemAdvantagesLimitationsSuitability for ArnE Production
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modificationsGood for initial structural studies
YeastEukaryotic post-translational processing, moderate yieldMore complex than bacterial systemsSuitable for functional studies
BaculovirusHigh-level expression, complex modificationsTime-consuming, specialized equipment requiredExcellent for detailed functional analyses
Mammalian CellNative-like modifications, proper foldingExpensive, lower yieldsBest for interaction studies

The choice of expression system significantly impacts the quality and characteristics of the recombinant protein, particularly for membrane proteins like ArnE that require proper folding and membrane integration for functional analysis.

Research Applications

Recombinant ArnE protein serves several important research applications:

  1. Structure-function studies to elucidate the mechanism of flippase activity

  2. Development of inhibitors targeting the LPS modification pathway

  3. Investigation of antimicrobial resistance mechanisms in Aeromonas salmonicida

  4. Immunological studies examining bacterial membrane antigen recognition

  5. Vaccine development research for fish furunculosis prevention

These applications highlight the significance of this protein in both basic science and applied research contexts. The specific focus on Aeromonas salmonicida makes this research particularly relevant to aquaculture and fish health management.

Functional Conservation

The high degree of conservation of this pathway across diverse Gram-negative bacteria suggests functional importance in bacterial survival and adaptation. In related bacterial species, mutations in the arn operon often result in increased susceptibility to antimicrobial peptides and certain antibiotics, underscoring the role of this pathway in antimicrobial resistance.

Related bacterial species, such as Salmonella paratyphi A, also possess homologous ArnE proteins with similar predicted functions . These homologous proteins provide valuable comparative models for understanding the function of the Aeromonas salmonicida ArnE protein through evolutionary and functional conservation analysis.

Implications for Pathogenesis and Antimicrobial Resistance

The modification of lipopolysaccharide through pathways involving the ArnE protein has significant implications for bacterial pathogenesis and antimicrobial resistance. In Aeromonas salmonicida, the ability to modify membrane structures may contribute to virulence through multiple mechanisms:

  1. Enhanced resistance to host antimicrobial peptides

  2. Altered recognition by host immune receptors

  3. Increased survival within host environments

  4. Modified biofilm formation capabilities

  5. Potential interference with antibiotic binding or penetration

Recent research has identified that A. salmonicida isolates can display major antigenic differences, with some strains lacking established virulence factors like VapA while still causing disease . This suggests complex adaptability in virulence mechanisms, potentially involving alternative pathways such as those related to membrane modification through proteins like ArnE.

Environmental Adaptation Mechanisms

The temperature-dependent expression of virulence factors in A. salmonicida, as demonstrated for the Type III Secretion System , suggests sophisticated regulatory mechanisms responsive to environmental cues. While specific data on ArnE regulation is not available in the search results, it is reasonable to hypothesize that similar environmental responsive mechanisms may regulate the expression of membrane modification systems involving ArnE.

The observed induction of TTSS expression at higher temperatures (28°C) but not at the bacterium's natural growth temperature (17°C) suggests adaptation to specific host or environmental conditions . Similar regulatory patterns might apply to LPS modification systems, potentially contributing to bacterial survival across various environmental niches.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Please note: All protein shipments include standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; ASA_3312; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Aeromonas salmonicida (strain A449)
Target Names
arnE
Target Protein Sequence
MDMLLLVLVCLLTCSGQMLQKQAVISWQRQPCSHWQKLFSPWLIASVVALGSGMLLWIYL LQRLPLSMAYPMLSINLVLVLIGSRLFFHEQISYHNWLGAGAIIIGALLLGGLL
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of ArnE in Aeromonas salmonicida?

The ArnE protein in Aeromonas salmonicida functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex. This membrane protein plays a crucial role in lipid trafficking across bacterial membranes, specifically facilitating the translocation of 4-amino-4-deoxy-L-arabinose-modified lipids. The protein's function is particularly significant as A. salmonicida is recognized as one of the oldest known fish pathogens with endemic status worldwide in both freshwater and marine environments .

The flippase activity of ArnE contributes to cell membrane integrity and potentially to antimicrobial resistance mechanisms. Structurally, ArnE belongs to a class of integral membrane proteins that typically contain multiple transmembrane domains arranged to form a pore or channel through which specific lipid substrates can be transported between membrane leaflets.

What expression systems are most effective for recombinant ArnE production?

Based on established protocols for similar bacterial membrane proteins, E. coli-based expression systems offer significant advantages for recombinant ArnE production. A recommended approach utilizes expression vectors containing inducible promoters, similar to the aTc-inducible system described for other membrane proteins . The expression protocol should incorporate the following methodology:

  • Transform the expression construct into an appropriate E. coli strain (BL21 or derivatives)

  • Culture transformants to mid-log phase (OD₆₀₀ of approximately 0.8)

  • Induce protein expression with an appropriate inducer (e.g., 0.2 mg/liter aTc)

  • Continue cultivation at reduced temperature (20-22°C) for 15-18 hours to facilitate proper protein folding

  • Harvest cells by centrifugation (5,000 × g for 10 minutes at 4°C)

This approach minimizes the formation of inclusion bodies and enhances the yield of correctly folded membrane protein. Temperature optimization is particularly critical for membrane proteins like ArnE to ensure proper insertion into the bacterial membrane during expression.

What purification strategies yield highest purity recombinant ArnE?

Purification of recombinant ArnE requires specialized approaches due to its membrane-associated nature. The following multi-step purification strategy has proven effective for similar membrane proteins:

  • Resuspend harvested cells in an appropriate buffer (e.g., 50 mM sodium phosphate pH 8.0, 150 mM NaCl, 15% glycerol)

  • Lyse cells using mechanical disruption (French pressure cell at 1,000 lb/in²)

  • Remove intact cells and debris by low-speed centrifugation (10,000 × g for 10 minutes)

  • Isolate membrane fractions by ultracentrifugation (125,000 × g for 2 hours)

  • Solubilize membrane proteins using gentle detergents (0.5% w/v dodecyl maltoside)

  • Remove insoluble material by a second ultracentrifugation step

  • Perform immobilized metal affinity chromatography (IMAC) for His-tagged ArnE

This protocol can be further optimized by incorporating size exclusion chromatography as a polishing step to remove aggregates and achieve higher homogeneity of the purified protein.

How can spectroscopic techniques be applied to characterize recombinant ArnE?

Comprehensive spectroscopic characterization of recombinant ArnE provides critical insights into its structural properties and cofactor composition. The following methodological approach is recommended:

  • UV-Visible Spectroscopy: Record absorption spectra of purified ArnE using a photodiode array photometer or UV-visible spectrophotometer in a 1-cm-path-length quartz cuvette . Analyze the spectra between 250-600 nm to identify characteristic absorption peaks that might indicate the presence of prosthetic groups or cofactors.

  • Fluorescence Spectroscopy: Utilize intrinsic protein fluorescence from aromatic residues (excitation at 280 nm) to assess protein folding and stability under various conditions.

  • Circular Dichroism (CD): Apply far-UV CD (190-250 nm) to determine secondary structure composition and near-UV CD (250-350 nm) to evaluate tertiary structure integrity.

  • FTIR Spectroscopy: Employ FTIR to analyze specific structural elements, particularly helpful for membrane proteins to assess transmembrane domain organization.

For prosthetic group identification, implement a denaturation protocol using 0.2% SDS followed by spectroscopic analysis of the released cofactor . This approach allows discrimination between covalently and non-covalently bound prosthetic groups by comparing spectra before and after protein denaturation.

What experimental approaches can determine ArnE's role in antibiotic resistance?

Investigation of ArnE's contribution to antibiotic resistance mechanisms requires multiple complementary approaches:

  • Gene Deletion Studies: Create ΔarnE knockout strains of A. salmonicida and evaluate changes in minimum inhibitory concentrations (MICs) against a panel of antibiotics, particularly cationic antimicrobial peptides.

  • Lipid Modification Analysis: Quantify 4-amino-4-deoxy-L-arabinose incorporation into lipopolysaccharide (LPS) in wild-type versus ΔarnE strains using mass spectrometry techniques.

  • Membrane Permeability Assays: Assess changes in membrane permeability using fluorescent dyes (e.g., propidium iodide, SYTOX Green) that penetrate cells with compromised membranes.

  • Recombinant Expression for Complementation: Express recombinant ArnE in knockout strains to confirm phenotype restoration, utilizing methods similar to those developed for recombinant adenovirus expression systems in A. salmonicida .

The table below summarizes expected outcomes from these experiments:

Experimental ApproachWild-type A. salmonicidaΔarnE MutantComplemented Strain
Polymyxin B MIC (μg/ml)High (>8)Low (<2)Restored (>6)
4-amino-4-deoxy-L-arabinose in LPSPresentReduced/AbsentRestored
Membrane integrityIntactCompromisedRestored
Growth in high salt mediaNormalImpairedNormal

How can structural biology techniques be applied to study ArnE?

Structural characterization of ArnE presents significant challenges due to its membrane-embedded nature. A multi-technique approach offers the best strategy:

  • X-ray Crystallography: Implement specialized crystallization techniques for membrane proteins including:

    • Lipidic cubic phase crystallization

    • Detergent screening (using a minimum of 10 different detergents)

    • Addition of lipids to stabilize the protein during crystallization

    • Use of antibody fragments to increase polar surface area

  • Cryo-Electron Microscopy: For high-resolution structural determination without crystallization:

    • Prepare proteoliposomes or nanodiscs containing purified ArnE

    • Optimize freezing conditions to minimize ice crystal formation

    • Collect images using direct electron detectors

    • Perform 3D reconstruction using single-particle analysis

  • Molecular Dynamics Simulations: Complement experimental data with computational approaches:

    • Construct homology models based on related flippase structures

    • Embed models in simulated lipid bilayers

    • Perform microsecond-scale simulations to assess conformational dynamics

    • Identify potential substrate interaction sites

These methods provide complementary information about ArnE structure, contributing to understanding its functional mechanism in lipid flipping across bacterial membranes.

How does ArnE from A. salmonicida compare to homologous proteins in other bacterial pathogens?

Comparative analysis of ArnE across bacterial species provides evolutionary and functional insights. Methodological approaches include:

  • Sequence-Based Phylogenetic Analysis:

    • Perform multiple sequence alignments of ArnE homologs from diverse bacteria

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Identify conserved regions that may indicate functional domains

    • Map species-specific variations to potential functional adaptations

  • Functional Complementation Studies:

    • Express A. salmonicida ArnE in heterologous bacterial systems lacking endogenous ArnE

    • Assess restoration of phenotypes including antimicrobial resistance

    • Quantify cross-species functional conservation through rescue efficiency

  • Structural Comparison:

    • Generate homology models of ArnE from different species

    • Overlay structures to identify conserved and variable regions

    • Correlate structural differences with host adaptation or pathogenicity

This comparative approach contextualizes A. salmonicida ArnE within the broader evolutionary landscape of bacterial flippase proteins and may identify unique features related to fish pathogenicity.

What is the relationship between ArnE and host-pathogen interactions in fish infections?

Understanding ArnE's role in host-pathogen dynamics requires investigation at molecular, cellular, and organism levels:

  • Ex Vivo Immune Cell Interaction Studies:

    • Isolate fish macrophages or neutrophils and challenge with wild-type and ΔarnE A. salmonicida

    • Quantify phagocytosis rates, respiratory burst activity, and cytokine production

    • Assess bacterial survival within phagocytes using confocal microscopy and viability assays

  • In Vivo Infection Models:

    • Challenge rainbow trout with wild-type, ΔarnE mutant, and complemented strains

    • Monitor survival rates and bacterial loads in tissues

    • Analyze immune responses including antibody production and cellular immunity

    • Compare pathological changes in infected tissues

  • Recombinant Vaccine Development:

    • Assess the potential of ArnE as a vaccine component, either alone or in combination with other A. salmonicida antigens

    • Evaluate protection conferred compared to established vaccines like those based on VapA

    • Measure specific immune responses including IgM and IgT levels in various tissues

Previous studies with recombinant adenovirus vaccines against A. salmonicida demonstrate the feasibility of this approach, with vaccination resulting in 60% survival compared to 23.4-26.4% in control groups following challenge .

What are the major obstacles in ArnE purification and how can they be overcome?

Membrane protein purification presents specific challenges requiring methodological refinements:

  • Protein Denaturation During Solubilization:

    • Implement a detergent screening protocol testing at least 12 different detergents at various concentrations

    • Utilize mild detergents like DDM (0.5% w/v) that balance extraction efficiency with protein stability

    • Add stabilizing agents like glycerol (15% v/v) to all buffers

    • Consider native nanodiscs or amphipols as alternatives to detergents

  • Low Expression Yields:

    • Optimize codon usage for expression host

    • Test multiple fusion tags (His, MBP, SUMO) to identify constructs with improved expression

    • Explore specialized E. coli strains developed for membrane protein expression

    • Consider cell-free expression systems with direct incorporation into liposomes

  • Protein Aggregation:

    • Implement a multi-step purification strategy incorporating size exclusion chromatography

    • Add specific lipids that stabilize the native structure

    • Utilize dynamic light scattering to monitor aggregation state

    • Optimize buffer conditions including pH, salt concentration, and additives

These approaches have been successful with similar membrane proteins and can be adapted specifically for recombinant ArnE from A. salmonicida.

How can researchers validate the functional activity of purified recombinant ArnE?

Functional validation of purified ArnE requires specialized assays that assess its flippase activity:

  • Reconstitution in Proteoliposomes:

    • Incorporate purified ArnE into preformed liposomes using detergent-mediated reconstitution

    • Verify incorporation using freeze-fracture electron microscopy and protein quantification

    • Assess protein orientation using protease protection assays

  • Flippase Activity Assays:

    • Prepare proteoliposomes with fluorescently labeled phospholipid analogs

    • Monitor translocation of labeled lipids between membrane leaflets using fluorescence spectroscopy

    • Quantify flipping rates under various conditions (pH, temperature, ionic strength)

  • Substrate Binding Studies:

    • Synthesize photo-activatable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol analogs

    • Perform photolabeling experiments to identify substrate binding sites

    • Validate binding specificity through competition assays with unlabeled substrate

These functional assays provide critical information about the biochemical activity of recombinant ArnE and help establish structure-function relationships.

How might ArnE serve as a target for novel antimicrobial development?

The strategic targeting of ArnE represents a promising approach for developing selective antimicrobials against A. salmonicida:

  • High-Throughput Inhibitor Screening:

    • Develop fluorescence-based assays suitable for screening compound libraries

    • Utilize recombinant ArnE in liposomes for functional inhibition assays

    • Prioritize compounds that specifically inhibit flippase activity

  • Structure-Based Drug Design:

    • Utilize structural models of ArnE to identify potential binding pockets

    • Perform in silico docking studies with virtual compound libraries

    • Design peptidomimetics that compete with natural substrates

  • Combination Therapy Approaches:

    • Evaluate synergistic effects between ArnE inhibitors and conventional antibiotics

    • Target multiple components of the lipid modification pathway simultaneously

    • Assess resistance development through serial passage experiments

Given A. salmonicida's significant economic impact on the salmon farming industry , development of novel therapeutics targeting ArnE could provide valuable alternatives to current treatment options.

What advanced analytical techniques can elucidate ArnE's role in bacterial membrane dynamics?

Next-generation analytical approaches offer unprecedented insights into membrane protein dynamics:

  • Single-Molecule Tracking:

    • Express fluorescently tagged ArnE variants in live bacteria

    • Utilize super-resolution microscopy (PALM/STORM) to track individual molecules

    • Analyze diffusion patterns and interaction dynamics in native membranes

  • Label-Free Mass Spectrometry:

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Identify regions with differential solvent accessibility in various functional states

    • Determine protein-lipid interaction interfaces

  • Neutron Reflectometry:

    • Create biomimetic membranes containing reconstituted ArnE

    • Analyze membrane structure and thickness changes during substrate translocation

    • Provide nanometer-scale resolution of protein orientation within membranes

These techniques provide complementary data about the dynamic behavior of ArnE during its functional cycle, informing both basic understanding and applied antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.