Recombinant Aeromonas salmonicida Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For multiple uses, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it.
Synonyms
htpX; ASA_2873; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Aeromonas salmonicida (strain A449)
Target Names
htpX
Target Protein Sequence
MKRIMLFLVTNLAVMLVLGVVLNILFSVLGINKSSISGLLMFCAVFGFGGSFISLLMSKW MAKRSYGVQVIEQPRNETEHWLVSTVARQAREAGIKMPEVGIYDSPEMNAFATGARRDDS LVAVSSGLLYSMSRDEAEAVLAHEVSHVANGDMVTLTLIQGVVNTFVMFFARIVAGVISN FFSSNNDEESSSSGGFAYMITVFVLEMAFGVLASMIVMWFSRQREFRADAGAAKLAGRDK MIAALQRLSRGAEPQMEGSMMAFGINGKRSMSELFMSHPPIEQRIAALRG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease in Aeromonas salmonicida and what is its functional role?

HtpX in A. salmonicida, like its homologs in other bacteria, is a membrane-bound zinc metalloprotease that plays a critical role in membrane protein quality control. Based on studies of HtpX in other bacterial species, this protease is involved in the degradation of misfolded or damaged membrane proteins, particularly under stress conditions such as elevated temperatures . The protease likely has its active site located on the cytosolic side of the cytoplasmic membrane, as demonstrated for E. coli HtpX .

In A. salmonicida, extracellular proteases are particularly significant for growth and survival, helping to supply the bacterium with available amino acids by breaking down environmental proteins . While the specific role of HtpX has not been fully characterized in A. salmonicida, it likely contributes to maintaining membrane integrity and protein homeostasis, which is essential for the pathogen's survival during infection processes.

What structural features characterize HtpX protease?

HtpX proteases across bacterial species share several conserved structural features:

  • A zinc-binding motif (HEXXH, where X represents any amino acid) essential for metalloprotease activity

  • Classification within the M48 family of zinc metalloproteinases

  • Typically contains four hydrophobic regions that may function as transmembrane segments

  • The glutamic acid residue within the HEXXH motif serves as a catalytic residue

For example, the B. subtilis HtpX is an integral membrane metalloprotease of 298 amino acids with its zinc-binding HEXXH motif at positions 155-159, where the glutamic acid at position 156 functions as the catalytic residue . The metal-binding properties of HtpX are significant for its function, as studies with recombinant DX-3-htpX protease have shown that binding of Ca²⁺ results in the formation of the largest active pocket .

How is the htpX gene regulated in bacteria?

The regulation of htpX gene expression varies across bacterial species but often involves heat-responsive mechanisms:

In Bacillus subtilis:

  • The htpX gene is under triple negative control by Rok, SigB, and YkrK

  • Expression is strongly heat-inducible

  • The triple negative control mechanism may prevent uncontrolled and potentially harmful overproduction of HtpX protease during heat stress

In Escherichia coli:

  • The htpX gene is regulated by the CpxR/CpxA two-component system

  • This stress response pathway is activated by the accumulation of abnormal cytoplasmic membrane proteins

In Streptococcus gordonii:

  • The htpX gene is associated with a polycistronic transcript of approximately 1.7-kb, also containing the lemA gene

  • Unlike heat shock genes such as dnaK, the lemA/htpX transcript does not show significantly increased levels in response to heat

This complex regulation suggests that htpX expression is carefully controlled to maintain proper protease levels according to cellular needs in different bacterial species.

What is the relationship between HtpX protease and bacterial heat stress response?

HtpX proteases are frequently associated with heat stress responses across bacterial species:

  • In Escherichia coli, HtpX is involved in membrane protein quality control, which becomes particularly important under heat stress conditions

  • In Bacillus subtilis, htpX gene expression is strongly heat-inducible, suggesting an important role during thermal stress

  • Research has shown that in B. subtilis, the absence of both FtsH and HtpX proteases causes severe growth defects under heat stress, whereas the absence of either protease alone did not significantly impair viability at high temperatures

  • This indicates that FtsH and HtpX may have partially overlapping functions in providing heat resistance

  • In Streptococcus gordonii, insertional inactivation of htpX resulted in changes in adhesiveness, cellular morphology, and detergent-extractable surface antigens in cells grown at 41°C, implying that htpX may be involved in surface protein expression during heat stress

The recombinant DX-3-htpX protease from Priestia megaterium has been characterized as a heat-resistant metalloprotease, further supporting the connection between HtpX and thermal stability .

What are the most effective methods for expressing and purifying recombinant A. salmonicida HtpX?

Based on successful expression systems used for other bacterial HtpX proteases, the following methodological approach is recommended:

  • Vector selection and construct design:

    • Use an expression vector with a strong inducible promoter (e.g., pHT43 with IPTG induction)

    • Include appropriate restriction sites (e.g., BamHI and SmaI) for efficient cloning

    • Consider adding affinity tags (His-tag or His-Myc tag) for purification purposes

  • Expression system:

    • E. coli BL21(DE3) can be used for initial transformation to improve efficiency

    • For optimal expression, consider Bacillus subtilis WB800N, which has been successfully used for recombinant protease expression

  • Induction and expression conditions:

    • Culture cells to OD600 ≈ 0.6–0.8 before induction

    • Add IPTG at a final concentration of 1 mM to induce protein expression

    • Optimize temperature and duration for expression (typically 16-37°C for 4-24 hours)

  • Purification strategy:

    • Centrifuge culture and collect the fermentation supernatant

    • Analyze protein expression using SDS-PAGE electrophoresis

    • For membrane-bound proteases like HtpX, consider detergent solubilization prior to purification

    • Use affinity chromatography (e.g., DEAE-cellulose column) for initial purification

    • Consider additional purification steps such as ion-exchange or size-exclusion chromatography

When expressing membrane proteases like HtpX, it's crucial to optimize conditions to maintain proper folding and activity. All experiments should be conducted in triplicate to ensure reproducibility .

How can researchers assess the in vivo activity of recombinant HtpX protease?

An in vivo assay system for HtpX protease activity has been developed for E. coli HtpX and can be adapted for A. salmonicida HtpX:

  • Model substrate construction:

    • Design and construct a model substrate specifically for HtpX (e.g., XMS1 - HtpX Model Substrate 1)

    • The model substrate should allow for semi-quantitative and convenient detection of protease activity

  • Detection system:

    • Implement a detection system that can identify different proteolytic fragments:

      • Full-length product (XMS1-FL)

      • C-terminal cleaved fragment (CL-C)

      • N-terminal cleaved fragment (CL-N)

  • Comparative analysis:

    • Compare wild-type HtpX activity with mutants carrying modifications in conserved regions

    • This approach enables detection of differential protease activities and structure-function relationships

  • Functional complementation:

    • For A. salmonicida specifically, assess the ability of recombinant HtpX to restore growth capabilities in protease-deficient mutants (similar to the NTG-1 strain)

    • Add the purified protease fraction to casein medium and measure growth rates

This in vivo assay system provides a powerful tool for investigating the functions of HtpX and its homologs across different bacterial species .

What are the overlapping functions between HtpX and other bacterial proteases like FtsH?

Research has revealed important functional relationships between HtpX and other proteases:

Understanding these overlapping yet distinct functions is crucial for comprehending the complete network of proteolytic quality control in bacterial membranes.

How can site-directed mutagenesis be used to investigate the functional domains of HtpX?

Site-directed mutagenesis is a powerful approach for investigating the functional domains of HtpX protease:

  • Target selection for mutagenesis:

    • Zinc-binding motif (HEXXH): Modify the conserved histidine or glutamic acid residues to assess their role in catalytic activity

    • Regulatory regions: Introduce mutations in promoter regions to study expression control

    • Transmembrane segments: Modify hydrophobic regions to investigate membrane topology and function

  • Methodological approach:

    • Two-step PCR method using specific primers for site-directed mutagenesis

    • For the zinc-binding motif, consider converting HEXXH to HAXXH or HEAAH to disrupt metal binding

    • For regulatory elements, introduce targeted mutations in the -10 box of the σA promoter (e.g., AAT to TTA mutation as used for htpX promoter studies)

  • Assessing mutant phenotypes:

    • Expression analysis: Northern hybridization to analyze transcript levels

    • Protease activity assays: Using model substrates to assess catalytic function

    • Growth analysis: Evaluating mutant strains under various stress conditions, particularly heat stress

    • Structural analysis: Use computational methods like AlphaFold3 and CASTpFold to predict structural changes in mutants

  • Example mutation strategy:

    • Target the conserved glutamic acid in the HEXXH motif (predicted catalytic residue)

    • Generate plasmids carrying specific mutations (e.g., pGS2415 with a 4-bp mutation GTTC to CAAG in regulatory regions)

    • Transform the constructs into appropriate host cells and analyze phenotypic changes

This approach allows researchers to systematically investigate structure-function relationships in HtpX protease, providing insights into its catalytic mechanism and biological role.

What role might HtpX play in A. salmonicida virulence and pathogenesis?

While direct evidence for HtpX's role in A. salmonicida virulence is limited, several potential contributions can be inferred:

  • Protease-dependent growth and nutrient acquisition:

    • A. salmonicida produces extracellular proteases that play a crucial role in supplying the bacterium with available amino acids as nutrients

    • Protease-deficient mutants show impaired growth in protein-based media unless supplemented with external protease

    • As a membrane protease, HtpX may contribute to the processing or regulation of these extracellular proteases

  • Stress adaptation during infection:

    • During infection, pathogens face various stresses including temperature fluctuations

    • HtpX's role in heat stress response suggests it may help A. salmonicida adapt to temperature changes encountered during host infection

    • The overlapping functions of HtpX and FtsH in heat resistance indicate a robust system for maintaining cellular integrity under stress

  • Membrane protein quality control:

    • Proper membrane function is essential for bacterial pathogenesis

    • HtpX's role in membrane protein quality control likely contributes to maintaining membrane integrity during infection

    • This may influence important virulence-related functions such as adhesion, invasion, and secretion systems

  • Potential research approaches:

    • Generate htpX knockout mutants of A. salmonicida and assess virulence in fish models

    • Compare proteome profiles of wild-type and htpX-deficient strains under infection-relevant conditions

    • Investigate whether htpX expression is upregulated during infection or exposure to host defense mechanisms

The connection between proteases and A. salmonicida pathogenicity is supported by the observation that protease production stimulates bacterial reproduction, which could enhance virulence during infection .

What experimental controls are essential when working with recombinant A. salmonicida HtpX?

When designing experiments with recombinant HtpX, the following controls are critical:

  • Expression system controls:

    • Non-induced samples: Culture without IPTG addition serves as a negative control for induction systems

    • Empty vector controls: Host cells transformed with the expression vector lacking the htpX insert

    • Positive expression controls: Well-characterized protein expressed under identical conditions

  • Activity assay controls:

    • Catalytic site mutants: HtpX variants with mutations in the HEXXH motif to confirm specificity

    • Heat-inactivated enzyme: Thermal denaturation to confirm enzymatic nature of observed activity

    • Protease inhibitor controls: Addition of specific metalloprotease inhibitors to confirm mechanism

  • Specificity controls:

    • Substrate variants: Modified substrates to confirm cleavage site specificity

    • Other metalloproteases: Comparison with related proteases to establish unique characteristics of HtpX

  • Physiological relevance controls:

    • Wild-type vs. htpX knockout strains: To assess phenotypic consequences of HtpX absence

    • Complementation tests: Restoration of phenotype by reintroduction of functional htpX gene

    • Multiple independent experimental replicates: All experiments should be conducted in triplicate to ensure reproducibility

These controls help establish the specificity, activity, and relevance of observations related to recombinant HtpX and minimize experimental artifacts.

How do temperature and metal ion concentrations affect HtpX activity and stability?

Temperature and metal ions significantly influence HtpX activity and stability:

  • Temperature effects:

    • HtpX proteases are often heat-resistant, as demonstrated by the DX-3-htpX protease

    • In B. subtilis, htpX expression is strongly heat-inducible, suggesting evolutionary adaptation to function under thermal stress

    • Optimum temperature for activity should be determined empirically for A. salmonicida HtpX

    • Heat stress (41°C) influences HtpX-dependent phenotypes in S. gordonii, affecting cellular morphology and surface proteins

  • Metal ion requirements:

    • As a zinc metalloprotease, HtpX requires Zn²⁺ for catalytic activity

    • Ca²⁺ binding to recombinant DX-3-htpX protease results in the formation of the largest active pocket, suggesting a structural role for calcium

    • Other divalent cations (Mg²⁺, Mn²⁺) may also influence activity or stability

  • Experimental approach to characterize metal and temperature dependencies:

    • Activity assays across temperature range (20-60°C) to determine thermal profile

    • Stability testing with pre-incubation at different temperatures

    • Metal chelation studies (EDTA, specific zinc chelators) to confirm metal dependency

    • Reconstitution experiments with different metal ions to assess specificity

    • Structural analysis using computational methods like CASTpFold to predict metal binding sites

This information is crucial for optimizing experimental conditions and understanding the physiological role of HtpX under various environmental conditions.

What bioinformatic approaches can help identify potential HtpX substrates in A. salmonicida?

Several bioinformatic strategies can help identify potential HtpX substrates:

  • Sequence-based approaches:

    • Analyze the A. salmonicida proteome for proteins with known HtpX cleavage site motifs

    • Identify membrane proteins with potential misfolding propensities

    • Search for proteins with exposed regions accessible to the cytosolic active site of HtpX

  • Structural prediction tools:

    • Use AlphaFold3 for tertiary structure prediction of potential substrates

    • Employ CASTpFold (http://sts.bioe.uic.edu/castp/index.html) to analyze potential binding and cleavage sites

    • Identify membrane proteins with structural features similar to known HtpX substrates

  • Comparative genomics:

    • Identify A. salmonicida homologs of known HtpX substrates from other bacterial species

    • Compare the membrane proteomes of A. salmonicida with those of E. coli and B. subtilis to identify conserved potential substrates

  • Protein-protein interaction prediction:

    • Use computational tools to predict potential interactions between HtpX and other A. salmonicida proteins

    • Look for proteins associated with the bacterial cytoskeleton, as HtpX in B. subtilis was proposed to be associated with the MreB cytoskeleton

  • Expression correlation analysis:

    • Identify A. salmonicida genes with expression patterns that correlate with htpX expression under stress conditions

    • Focus on membrane proteins whose expression is altered under conditions where htpX is upregulated

These bioinformatic approaches provide valuable starting points for experimental validation of potential HtpX substrates in A. salmonicida.

How should researchers analyze and compare HtpX activity across different experimental conditions?

To effectively analyze HtpX activity across experimental conditions:

  • Quantitative activity measurements:

    • Develop standardized assays using model substrates like XMS1

    • Measure initial rates of substrate cleavage under defined conditions

    • Use appropriate software (e.g., Origin 2021) for data analysis and graphing

  • Statistical analysis:

    • Conduct all experiments in triplicate and report results as mean value ± standard deviation

    • Apply appropriate statistical tests to determine significance of observed differences

    • Generate line graphs to visualize activity profiles under varying conditions

  • Comparative analysis framework:

    • Temperature dependence: Plot activity vs. temperature curves (20-60°C)

    • pH profiling: Determine activity across pH range (5-9) to classify as acidic, neutral, or alkaline protease

    • Metal ion effects: Compare activity with different metal ions and concentrations

    • Substrate specificity: Analyze cleavage patterns with different model substrates

  • Kinetic parameter determination:

    • Calculate Km, Vmax, and kcat values under different conditions

    • Determine inhibition constants with various protease inhibitors

    • Use Lineweaver-Burk or Eadie-Hofstee plots for kinetic analysis

  • Visualization and documentation:

    • Use SDS-PAGE electrophoresis to visualize protein expression and purification

    • Document protease activity through substrate cleavage patterns

    • Support with tertiary structure models and binding pocket analyses

This systematic approach ensures reliable comparison of HtpX activity across different experimental conditions while maintaining scientific rigor.

What are the key considerations when comparing HtpX from different bacterial species?

When comparing HtpX proteases across bacterial species, researchers should consider:

  • Sequence and structural homology:

    • Align amino acid sequences to identify conserved domains and species-specific variations

    • Compare the zinc-binding HEXXH motif and surrounding residues

    • Analyze predicted membrane topology and transmembrane segments

    • Use computational tools like InterPro for conserved domain analysis

  • Regulatory mechanisms:

    • Compare promoter regions and transcriptional regulation

    • Analyze whether heat inducibility is conserved (as in B. subtilis) or absent (as in S. gordonii)

    • Determine if the gene exists in an operon (as in S. gordonii with lemA/htpX) or as a standalone gene

  • Functional characteristics:

    • Compare substrate specificity profiles

    • Analyze temperature optima and heat resistance properties

    • Assess metal ion dependencies and active site configurations

    • Evaluate physiological roles in different bacterial contexts

  • Experimental approach for cross-species comparison:

    • Create standardized expression systems for multiple HtpX orthologs

    • Test each ortholog against a panel of identical substrates

    • Compare complementation ability in htpX-deficient strains

    • Evaluate structural predictions using consistent computational methods

  • Comparative table example:

SpeciesProtein LengthHEXXH PositionHeat InducibleRegulatory SystemKey Function
B. subtilis298 aa155-159YesRok, SigB, YkrKHeat resistance
E. coliVariablePresentVariableCpxR/CpxAMembrane protein quality
S. gordoniiVariablePresentNoPolycistronic with lemASurface protein expression
A. salmonicidaTo be determinedPredictedPredictedTo be investigatedGrowth/survival

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.