Recombinant Aeromonas salmonicida Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aeromonas salmonicida Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (ArnC)

Recombinant Aeromonas salmonicida Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, commonly referred to as ArnC, is an enzyme involved in bacterial lipopolysaccharide (LPS) biosynthesis. Specifically, ArnC is a glycosyltransferase that participates in modifying lipid A, a component of LPS, which is crucial for the structure and function of the outer membrane in Gram-negative bacteria . The enzyme is found in Aeromonas salmonicida, a bacterium known to cause furunculosis in fish .

Function and Mechanism

ArnC is a type-2 glycosyltransferase (GT-2) that modifies lipid A by adding an Ara-4N headgroup, which stands for 4-deoxy-4-formamido-L-arabinose . This modification confers resistance against polymyxins, a class of antimicrobial peptides . Polymyxins target the LPS layer, but the addition of Ara-4N alters the LPS structure, reducing the binding affinity of polymyxins and, therefore, their effectiveness .

The deletion of the arnC gene in polymyxin-resistant E. coli decreases the level of UndP-Ara4FN, while the deletion of the adjacent arnD gene leads to the accumulation of UndP-Ara4FN, which confirms ArnC's role in the formation of UndP-Ara4FN .

2.1. Molecular Structure

The ArnC protomer consists of three distinct regions :

  • An N-terminal glycosyltransferase domain.

  • A transmembrane region.

  • Interface helices (IHs).

ArnC forms a stable tetramer with C2 symmetry through interactions in the C-terminal region, which is expected to protrude into the cytosol .

2.2. Catalytic Activity

The binding of UDP induces conformational changes that stabilize the A-loop and part of the putative catalytic pocket formed by IH1 and IH2 .

Role in Polymyxin Resistance

The modification of lipid A by ArnC is a critical mechanism of polymyxin resistance in Gram-negative bacteria . As polymyxins are often used as a last-resort antibiotic against multidrug-resistant bacteria, understanding the mechanisms of resistance, such as ArnC's function, is vital .

4.1. Cryo-EM Structure of Salmonella typhimurium ArnC

Cryogenic electron microscopy (cryo-EM) has been used to determine the structures of Salmonella typhimurium ArnC in both apo and UDP-bound forms . The structure of the ArnC protomer follows the architecture observed in other membrane-bound glycosyltransferases and consists of three regions :

  • The N-terminal region (residues 1 to 153) folds into a Rossman-like α-β domain that is similar to the canonical GT-A domain common for the GT-2 family of glycosyltransferases.

  • Two α-helices (α6 and α9) positioned along the expected plane of the membrane, referred to as interface helix 1 (IH1) and interface helix 2 (IH2).

  • The C-terminal portion of ArnC contains two transmembrane (TM) helices, which are referred to as TM1 and TM2.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnC; ASA_3308; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Aeromonas salmonicida (strain A449)
Target Names
arnC
Target Protein Sequence
MNNTDIKLVSVIIPVYNEEASLPVLLSRVTAACELLPQDYEVILIDDGSHDGSTEIISEA AANSDSKLVGVLLNRNYGQHAAIMAGFETAKGDLVITLDADLQNPPEEIPRLVEAAMQGY DVVGTVRRNRQDSWFRKTASRLINKSMQKATGVHMSDYGCMLRAYRRHIIDAMLCCQERS TFIPILANSFARRTIELEVGHAERAHGESKYGLMHLINLMYDLVTCMTTTPLRLLSIVGS LVAGLGFTFSILLVLMRLVMGADWAADGVFTLFAILFTFVGVQLLGMGLLGEYIGRMYTD VRARPRYFIHQIVRTATPSQQETEQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in A. salmonicida?

ArnC in A. salmonicida catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modification is crucial for lipid A structure, which forms part of the bacterial lipopolysaccharide (LPS) outer membrane. The modified arabinose attachment to lipid A confers resistance to polymyxin and cationic antimicrobial peptides . In the context of A. salmonicida pathogenesis, this enzyme likely contributes to antimicrobial resistance mechanisms, which is particularly relevant given the increasing antibiotic resistance concerns in aquaculture settings .

What is the genetic organization of the arn operon in A. salmonicida?

While the specific genetic organization in A. salmonicida is not explicitly detailed in the available literature, the arn operon typically consists of multiple genes involved in L-Ara4N modification of lipid A. Based on analogous systems in other bacteria, the arnC gene is likely part of the arnBCADTEF operon, which encodes enzymes responsible for the biosynthesis pathway of undecaprenylphosphate α-L-Ara4N . This operon is typically regulated in response to environmental signals such as low Mg²⁺ and the presence of antimicrobial peptides. In the context of A. salmonicida's genome, recent sequencing studies in Chilean isolates have identified various structural modifications in genomic organization compared to reference strains, which could potentially affect the regulation and function of virulence-associated operons like arn .

What expression systems are most effective for producing recombinant A. salmonicida arnC protein?

Several expression systems have been successfully used for recombinant A. salmonicida proteins, although specific data for arnC is limited. Based on available information:

  • Escherichia coli expression system: Most commonly used, as evidenced by successful expression of recombinant A. salmonicida outer membrane proteins including OmpA, OmpC, OmpK, and OmpW . For arnC specifically, E. coli expression with N-terminal His-tagging has been reported .

  • Alternative systems: Yeast, baculovirus, and mammalian cell expression systems are potential alternatives for arnC expression when eukaryotic post-translational modifications or improved solubility are required .

The choice of expression system should be guided by:

  • Protein solubility requirements

  • Need for post-translational modifications

  • Intended downstream applications (e.g., structural studies vs. immunological assays)

  • Scale of production needed

For initial characterization studies, the E. coli system with appropriate solubility tags is recommended based on successful expression of other A. salmonicida proteins.

What purification strategies yield the highest purity and activity for recombinant arnC protein?

Effective purification of recombinant arnC requires a multi-step approach, typically including:

  • Affinity chromatography: His-tagged recombinant arnC protein can be purified using nickel or cobalt affinity resins . This approach allows for single-step enrichment with reasonable purity.

  • Size exclusion chromatography: Following affinity purification, size exclusion chromatography can separate monomeric arnC from aggregates and other contaminants, improving homogeneity.

  • Ion exchange chromatography: This can be employed as an additional purification step based on the calculated isoelectric point of arnC.

A typical purification protocol might include:

  • Cell lysis in appropriate buffer (typically Tris/PBS-based with protease inhibitors)

  • Clarification of lysate by centrifugation

  • Affinity purification using His-tag

  • Buffer exchange to remove imidazole

  • Size exclusion chromatography for final purification

Storage conditions are critical for maintaining activity, with recommended storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

How can researchers overcome solubility challenges when working with recombinant A. salmonicida arnC?

ArnC is a transmembrane protein , which presents inherent solubility challenges. Researchers can employ several strategies to address these issues:

  • Fusion tags: Beyond His-tags for purification, solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Thioredoxin can significantly improve protein solubility.

  • Expression conditions optimization:

    • Lower induction temperature (16-20°C)

    • Reduced IPTG concentration

    • Extended expression time at lower temperatures

  • Buffer optimization:

    • Addition of glycerol (5-10%)

    • Inclusion of mild detergents (0.5-1% CHAPS, 0.1% DDM, or 0.5% Triton X-100)

    • Testing various pH conditions (typically pH 7.5-8.5)

    • Addition of stabilizing agents like trehalose (6% as used in commercial preparations)

  • Truncation constructs: Removing transmembrane domains while retaining the catalytic domain can improve solubility for functional studies.

  • Cell-free expression systems: For particularly challenging cases, cell-free expression systems have been used successfully for transmembrane proteins like arnC .

What assays can be used to measure the enzymatic activity of recombinant A. salmonicida arnC?

The enzymatic activity of recombinant arnC can be assessed using several complementary approaches:

  • Substrate conversion assay: Monitoring the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This can be quantified by:

    • HPLC separation of substrates and products

    • Mass spectrometry detection of reaction products

    • Radiolabeled substrate assays using ³²P-labeled UDP or ¹⁴C-labeled arabinose

  • Coupled enzyme assays: Linking arnC activity to a detectable enzymatic reaction, such as UDP release coupled to NADH oxidation through pyruvate kinase and lactate dehydrogenase.

  • Fluorescence-based assays: Using fluorescently labeled substrate analogs to monitor reaction progress in real-time.

  • Functional complementation: Testing the ability of recombinant arnC to restore polymyxin resistance in arnC-deficient bacterial strains.

The specific reaction catalyzed by arnC is:
UDP-4-deoxy-4-formamido-β-L-arabinose + di-trans,octa-cis-undecaprenyl phosphate → UDP + 4-deoxy-4-formamido-α-L-arabinose di-trans,octa-cis-undecaprenyl phosphate

How does the structure of arnC inform our understanding of its catalytic mechanism?

The structure of arnC provides insights into its catalytic mechanism, although specific structural data for A. salmonicida arnC is limited. Based on computational structure models from Aeromonas hydrophila (a related species) and functional studies:

  • Structural domains:

    • N-terminal catalytic domain (containing the active site for arabinose transfer)

    • C-terminal membrane-anchoring domain (facilitating interaction with lipid substrates)

  • Active site residues:

    • Conserved residues likely involved in UDP-arabinose binding

    • Hydrophobic pocket accommodating the undecaprenyl phosphate substrate

  • Catalytic mechanism:

    • The enzyme likely facilitates nucleophilic substitution at the anomeric carbon

    • Conserved basic residues may stabilize the leaving UDP group

    • The membrane-proximal region positions the undecaprenyl phosphate acceptor

The pLDDT confidence score for the AlphaFold model of A. hydrophila arnC is 82.37 (global) , indicating a relatively confident structural prediction that can guide mechanistic hypotheses, though experimental validation through site-directed mutagenesis would be necessary.

What techniques are available for studying arnC interactions with other components of the LPS modification pathway?

Several advanced techniques can elucidate arnC interactions within the LPS modification pathway:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of arnC with other Arn pathway proteins

    • Bacterial two-hybrid assays for detecting direct interactions

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Crosslinking mass spectrometry to map interaction interfaces

  • Substrate binding analysis:

    • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

    • Microscale thermophoresis (MST) for measuring binding affinities

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map structural changes upon substrate binding

  • Multiprotein complex analysis:

    • Blue native PAGE for intact complex isolation

    • Cryo-electron microscopy for structural characterization of larger assemblies

    • Native mass spectrometry for stoichiometry determination

  • In vivo pathway mapping:

    • Proximity labeling techniques (BioID, APEX) to identify nearby proteins in the native environment

    • Fluorescence microscopy with protein fusions to track localization

    • Metabolic labeling of LPS intermediates combined with immunoprecipitation

These techniques can reveal how arnC functions within the larger context of LPS modification and antimicrobial resistance mechanisms in A. salmonicida.

How does arnC contribute to antimicrobial peptide resistance in A. salmonicida?

ArnC plays a critical role in antimicrobial peptide resistance through its function in LPS modification:

  • Mechanism of resistance:

    • The addition of 4-amino-4-deoxy-L-arabinose (L-Ara4N) to lipid A reduces the negative charge of the bacterial outer membrane

    • This modification decreases the electrostatic attraction between cationic antimicrobial peptides and the bacterial surface

    • The altered membrane charge prevents antimicrobial peptides from inserting into and disrupting the membrane

  • Evidence from related bacteria:

    • Studies in related species show that mutations in arnC lead to increased susceptibility to polymyxin and other cationic antimicrobial peptides

    • The complete LPS modification pathway, including arnC, is required for full resistance

  • Relevance to A. salmonicida pathogenesis:

    • This resistance mechanism likely helps A. salmonicida evade fish innate immune defenses

    • Recent genomic analysis of A. salmonicida strains shows variations in virulence factors, including differences in exotoxin patterns between typical and atypical psychrophilic isolates, which may interact with membrane modification systems

The importance of antimicrobial peptide resistance in A. salmonicida is underscored by recent findings on the increasing antimicrobial resistance in aquaculture settings, where strains from French trout farms showed resistance to multiple antibiotics .

What is the relationship between arnC-mediated LPS modifications and other virulence factors in A. salmonicida?

The relationship between arnC-mediated LPS modifications and other virulence factors in A. salmonicida involves complex interactions:

  • Coordination with outer membrane proteins:

    • LPS modifications affect the structure and function of outer membrane proteins (OMPs)

    • Several OMPs, including OmpA, OmpC, OmpK, and OmpW, have been identified as immunogenic and protective in vaccination studies

    • The stability and function of these OMPs may depend on proper LPS structure

  • Impact on secretion systems:

    • Altered LPS structure can influence the assembly and function of type III secretion systems

    • Genomic analysis has revealed differences in virulence factors between typical and atypical A. salmonicida strains, including exotoxin distributions

  • Biofilm formation:

    • LPS modifications can affect bacterial adhesion properties and biofilm formation

    • The A-layer (a surface protein array) is a key virulence factor in A. salmonicida that may interact with modified LPS structures

  • Immune evasion strategies:

    • Beyond direct antimicrobial peptide resistance, LPS modifications can alter recognition by pattern recognition receptors of the host immune system

    • This may complement other immune evasion strategies employed by A. salmonicida

Understanding these interactions is crucial for developing comprehensive therapeutic approaches against A. salmonicida infections in aquaculture.

How can arnC function be targeted for potential therapeutic applications against A. salmonicida infections?

ArnC represents a promising therapeutic target due to its role in antimicrobial resistance. Several approaches for targeting arnC function include:

  • Small molecule inhibitors:

    • Rational design of competitive inhibitors for the UDP-arabinose binding site

    • Allosteric inhibitors targeting regulatory domains

    • Structure-based virtual screening against the arnC catalytic domain

  • Combination therapy approaches:

    • Pairing arnC inhibitors with conventional antibiotics to overcome resistance

    • Using arnC inhibitors to sensitize A. salmonicida to host antimicrobial peptides

    • Combined targeting of multiple LPS modification enzymes

  • Peptide-based inhibitors:

    • Designing peptides that interfere with arnC-substrate interactions

    • Developing cell-penetrating peptides that can access the inner membrane where arnC functions

  • Anti-virulence approach:

    • Rather than killing bacteria directly, arnC inhibition could reduce pathogenicity by increasing susceptibility to host defense mechanisms

    • This approach might reduce selective pressure for developing resistance

Challenges in targeting arnC include:

  • Ensuring selective toxicity (targeting bacterial but not host enzymes)

  • Achieving sufficient bioavailability in aquaculture settings

  • Developing delivery methods appropriate for fish farming contexts

Recent research on A. salmonicida antimicrobial susceptibility could inform these approaches, as studies have shown various resistance patterns in isolates from trout farms .

How does recombinant arnC compare to other A. salmonicida antigens as a vaccine candidate?

When evaluating recombinant arnC as a vaccine candidate compared to other A. salmonicida antigens, several factors must be considered:

AntigenProtective Efficacy (RPS)Immune ResponseAdvantagesLimitations
rOmpC81.6%Strong humoral response; enhanced MHC-II, TCR, CD4, CD8, IL-8, IgM gene expressionHighest protection among tested OMPs; induces strong antibody productionMay have strain-specific variations
rOmpA71.1%Good humoral responseHigh protectionLower efficacy than OmpC
rOmpK55.3%Moderate immune responseModerate protectionLess effective than OmpA/OmpC
rOmpW42.1%Lower immune responseRecognized by fish antibodiesLowest protection among tested OMPs
VapA (A-layer protein)Significant reduction in mortality (40% vs 76.6% in control)Increased specific antibodies; elevated IgM and IgT levelsHighly immunogenic; targets a key virulence factorRequires specialized delivery (adenovirus vector)
arnCNot directly testedUnknown for A. salmonicidaPotential to target antimicrobial resistanceLimited immunogenicity data; mainly intracellular

An in vivo challenge trial of subunit vaccines containing 14 different recombinant proteins showed that various protein combinations provided significant protection, with mortality rates of 17-30% compared to 48-56% in control groups . This suggests that multi-antigen approaches may be most effective.

What are the methodological considerations for evaluating recombinant arnC as a vaccine component?

Evaluating recombinant arnC as a vaccine component requires comprehensive methodological approaches:

  • Antigen formulation and delivery:

    • Selection of appropriate adjuvants (oil-based adjuvants have shown efficacy for A. salmonicida vaccines)

    • Determination of optimal dose through dose-response studies

    • Evaluation of delivery methods (injection, immersion, oral delivery)

    • Stability testing under aquaculture conditions

  • Immunogenicity assessment:

    • Measurement of specific antibody responses using ELISA

    • Analysis of cellular immune responses (T-cell proliferation assays)

    • Gene expression analysis of immune-related genes (MHC-II, TCR, CD4, CD8, IL-8, IgM, IgT)

    • Immunohistochemistry to assess tissue-specific responses

  • Efficacy evaluation:

    • Controlled challenge studies under laboratory conditions

    • Calculation of relative percent survival (RPS)

    • Assessment of bacterial load in tissues following challenge

    • Long-term protection studies to determine duration of immunity

  • Combination studies:

    • Testing arnC in combination with established protective antigens (e.g., OmpC)

    • Evaluating potential synergistic or antagonistic effects in multi-antigen formulations

    • Determining optimal antigen ratios for balanced immune responses

  • Field trials:

    • Assessment under real aquaculture conditions

    • Monitoring for adverse effects and impact on fish growth

    • Economic analysis of vaccine implementation costs versus disease losses

These methodological approaches should be designed following successful models from previous A. salmonicida vaccine studies, where significant protection was achieved through systematic evaluation of candidate antigens .

How might genetic diversity in arnC across A. salmonicida strains affect vaccine development?

Genetic diversity in arnC across A. salmonicida strains has significant implications for vaccine development:

  • Strain variation analysis:

    • Recent genomic studies have revealed substantial genomic diversity among A. salmonicida isolates, particularly between typical psychrophilic, atypical psychrophilic, and mesophilic strains

    • Unique gene families contribute to differences between these clades, which could include variations in arnC and related pathways

    • Insertion sequences and restriction-modification patterns highlight genomic structural differences that may affect antigen expression

  • Cross-protection challenges:

    • Variations in arnC sequence or expression levels could result in strain-specific immunity

    • Conserved epitopes must be identified for broad-spectrum protection

    • Phylogenomic analysis can guide the selection of representative strains for vaccine development

  • Geographic considerations:

    • Recent outbreaks of A. salmonicida in Chilean Atlantic salmon revealed genomic patterns distinct from previously characterized isolates

    • Regional differences in antibiotic resistance patterns have been observed in A. salmonicida isolates from French trout farms

    • Vaccine formulations may need to be adapted to regional strain distributions

  • Adaptive strategies:

    • Multi-epitope approaches targeting conserved regions of arnC and other antigens

    • Inclusion of antigens from multiple strains in polyvalent vaccines

    • Regular monitoring of circulating strains for vaccine updates, similar to influenza vaccine strategy

The genomic plasticity of A. salmonicida, evidenced by diverse insertion sequences and restriction-modification systems , suggests that ongoing surveillance and potential vaccine updates may be necessary to maintain effectiveness against evolving strains.

What are the current limitations in our understanding of arnC function in A. salmonicida and how might they be addressed?

Current knowledge gaps and research approaches include:

  • Structural characterization limitations:

    • While computational models exist for related species , no experimental structure is available for A. salmonicida arnC

    • Future approach: X-ray crystallography or cryo-EM studies of purified protein, potentially with substrate analogs

  • Regulatory network uncertainty:

    • Limited understanding of how environmental signals regulate arnC expression in A. salmonicida

    • Future approach: Transcriptomic analysis under various conditions (temperature, pH, antimicrobial exposure)

  • Host-pathogen interaction gaps:

    • Unknown how fish immune systems specifically recognize LPS modifications

    • Future approach: Studies on fish antimicrobial peptide interactions with modified vs. unmodified A. salmonicida membranes

  • Substrate specificity questions:

    • Lack of information on potential alternative substrates for A. salmonicida arnC

    • Future approach: Biochemical characterization with substrate analogs and metabolomics profiling

  • In vivo function verification:

    • Limited validation of arnC function in live A. salmonicida cells

    • Future approach: Generation of arnC knockout strains and complementation studies

Addressing these limitations requires interdisciplinary approaches combining structural biology, microbial genomics, biochemistry, and host-pathogen interaction studies. Recent advances in genomic analysis of A. salmonicida strains provide a foundation for more targeted studies of arnC and related systems.

How can advanced molecular techniques be applied to better understand arnC's role in A. salmonicida pathogenesis?

Advanced molecular techniques offer new opportunities to elucidate arnC's role in pathogenesis:

  • CRISPR-Cas9 gene editing:

    • Generation of precise arnC mutations or deletions

    • Creation of reporter fusions to monitor expression in vivo

    • Introduction of tagged versions for protein localization studies

  • Single-cell analysis technologies:

    • RNA-seq at single-cell level to detect heterogeneous expression

    • Time-lapse microscopy with fluorescent reporters to track dynamic regulation

    • Mass cytometry to correlate arnC expression with phenotypic states

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize arnC localization relative to other membrane components

    • Correlative light and electron microscopy to connect protein location with membrane ultrastructure

    • Label-free imaging techniques to observe LPS modifications in living cells

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics) to place arnC in global regulatory networks

    • Network analysis to identify key interactions and regulatory hubs

    • Predictive modeling of antimicrobial resistance based on pathway activities

  • Host-pathogen interaction technologies:

    • Organ-on-chip models simulating fish tissues for controlled infection studies

    • CRISPR screens to identify host factors that interact with arnC-modified LPS

    • In vivo imaging of infections in transparent fish models (e.g., zebrafish larvae)

These advanced techniques could provide deeper insights into how arnC and related LPS modifications contribute to A. salmonicida pathogenesis in the context of actual host environments and immune responses.

What emerging technologies might revolutionize our ability to target arnC for therapeutic or preventive applications?

Several emerging technologies hold promise for targeting arnC in novel therapeutic or preventive applications:

  • RNA-based technologies:

    • mRNA vaccines encoding arnC or other A. salmonicida antigens

    • siRNA or antisense oligonucleotides targeting arnC expression

    • CRISPR-Cas13 systems for targeted RNA degradation in bacteria

  • Antibody engineering:

    • Single-domain antibodies (nanobodies) that can penetrate bacterial membranes

    • Bispecific antibodies targeting both arnC and surface antigens

    • Antibody-antibiotic conjugates for targeted delivery

  • Nanotechnology approaches:

    • Nanoparticle-based delivery of arnC inhibitors to infected tissues

    • Nanobiosensors for detecting arnC activity or modified LPS

    • Functionalized nanoparticles that bind to bacterial surfaces and inhibit membrane synthesis

  • Phage therapy innovations:

    • Engineered bacteriophages targeting A. salmonicida

    • Phage enzymes (endolysins) that can degrade bacterial cell walls

    • CRISPR-delivered phages targeting arnC genes

  • Synthetic biology solutions:

    • Engineered probiotics expressing anti-A. salmonicida factors

    • Synthetic membrane-targeting peptides designed to interact with modified LPS

    • Cell-free expression systems for on-demand vaccine production

  • AI-driven approaches:

    • Machine learning for predicting effective arnC inhibitors

    • AI-designed multi-epitope vaccines incorporating arnC epitopes

    • Computational models predicting resistance evolution

These emerging technologies could address current limitations in treating A. salmonicida infections, particularly in the context of increasing antibiotic resistance in aquaculture settings . The development of such approaches would benefit from the growing understanding of A. salmonicida genomics and pathogenesis mechanisms .

Bibliography

  • Liu Y, et al. (2020). Recombinant outer membrane protein C of Aeromonas salmonicida subsp. masoucida induces protective immunity in rainbow trout. Fish & Shellfish Immunology, 103, 52-58.

  • Van Moncayo G, et al. (2023). Genomics of Re-Emergent Aeromonas salmonicida in Atlantic Salmon. Pathogens, 12(1), 57.

  • Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (Escherichia coli HS). (2025). PubChem.

  • Xiong J, et al. (2019). A recombinant adenovirus targeting typical Aeromonas salmonicida induces effective immunity in rainbow trout. Fish & Shellfish Immunology, 88, 77-82.

  • Marana MH, et al. (2017). Subunit vaccine candidates against Aeromonas salmonicida in rainbow trout Oncorhynchus mykiss. PLoS ONE, 12(2), e0171944.

  • Undecaprenyl phosphate-4-amino-4-formyl-L-arabinose (PAMDB001761). (2018). Pseudomonas Aeruginosa Metabolome Database.

  • Moreau E, et al. (2025). Susceptibility of Aeromonas salmonicida subsp. salmonicida to antimicrobials. Frontiers in Microbiology, 16, 1532748.

  • Aeromonas salmonicida. (2024). Wikipedia.

  • Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC). (2014). MyBioSource.

  • Recombinant Aeromonas Salmonicida arnC Protein. (n.d.). Creative Biolabs.

  • Recombinant Full Length Undecaprenyl-Phosphate 4-Deoxy-4-Formamido-L-Arabinose Transferase(arnC) Protein, His-Tagged. (2025). Creative Biomart.

  • AF_AFA0KGY7F1: Computed structure model of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase. (2022). RCSB Protein Data Bank.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.