Recombinant Aeromonas salmonicida UPF0060 membrane protein ASA_2267 (ASA_2267)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ASA_2267; UPF0060 membrane protein ASA_2267
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Aeromonas salmonicida (strain A449)
Target Names
ASA_2267
Target Protein Sequence
MVELKTIGLFLITAVAEIVGCYLPYLWLTQGRSVWLLLPAGLSLVLFAWLLSLHPTAAGR VYAAYGGVYIFVAILWLWLVDGIRPTLWDLVGSLVALFGMAIIMFAPRPA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant production of ASA_2267?

For recombinant production of ASA_2267, several expression systems have been validated with varying advantages:

Expression SystemAdvantagesConsiderationsRecommended For
E. coliHighest yield, shorter turnaround timeLimited post-translational modificationsStructural studies, antibody production
YeastGood yield, some post-translational modificationsIntermediate complexityFunctional studies requiring some modifications
Insect cellsBetter post-translational modificationsLonger production time, more complexStudies requiring proper protein folding
Mammalian cellsMost complete post-translational modificationsLowest yield, most complex, most expensiveStudies requiring native-like activity

E. coli is generally the preferred system for initial characterization and structural studies, as it provides sufficient yields while maintaining reasonable turnaround times . The protein has been successfully expressed in E. coli with N-terminal His-tags, resulting in stable protein preparations suitable for further analysis .

What are the optimal storage conditions for recombinant ASA_2267?

Based on established protocols for recombinant ASA_2267, the following storage conditions are recommended to maintain protein stability and function:

  • Short-term storage (up to one week): 4°C in appropriate buffer

  • Long-term storage: -20°C to -80°C in buffer containing stabilizers

  • Recommended buffer composition: Tris-based buffer with 50% glycerol, pH 8.0

  • Alternative formulation: Tris/PBS-based buffer with 6% trehalose, pH 8.0

For lyophilized preparations, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol (final concentration 30-50%) for storage stability . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity. Working aliquots should be prepared upon initial thawing to minimize degradation .

How does ASA_2267 relate to the pathogenicity of Aeromonas salmonicida?

While the direct role of ASA_2267 in pathogenicity has not been fully elucidated, it exists within the context of a significant fish pathogen. Aeromonas salmonicida is one of the oldest known fish pathogens and causes furunculosis, particularly in salmonids . This disease is characterized by high mortality and morbidity in both wild and farmed fish in freshwater and saltwater environments .

A. salmonicida subsp. salmonicida (ASS) is responsible for significant economic losses in the global aquaculture industry, especially in salmonid farming due to its severe infectivity . The disease tends to occur more frequently when water temperatures are higher, making it an increasing concern in the context of global warming .

As a membrane protein, ASA_2267 may potentially be involved in:

  • Cellular adaptation to environmental conditions

  • Transport functions

  • Cell signaling

  • Structural integrity of the bacterial membrane

Further research is needed to determine the specific functional role of ASA_2267 in bacterial physiology and potential contributions to pathogenicity.

What experimental design considerations are critical when studying ASA_2267 function?

When designing experiments to investigate ASA_2267 function, researchers should implement a structured approach that maximizes statistical power while minimizing potential sources of bias:

  • Control of Variables: Identify and control all possible variables that might influence experimental outcomes. For membrane proteins, these include :

    • Detergent concentration and type

    • Buffer composition and pH

    • Temperature during protein handling

    • Protein concentration and purity

    • Time exposed to various experimental conditions

  • Statistical Power Planning: Conduct power analysis to determine appropriate sample size using the formula:

    n=2(Zα/2+Zβ)2σ2Δ2n = \frac{2(Z_{\alpha/2} + Z_{\beta})^2\sigma^2}{\Delta^2}

    Where n = sample size, Z = standard normal deviate, σ = standard deviation, and Δ = minimum detectable difference .

  • Data Collection Structure: Organize data collection in properly formatted tables with clearly defined independent variables (IV) and dependent variables (DV)6 :

    TrialIV (Condition)DV1 (Measurement 1)DV2 (Measurement 2)DV3 (Measurement 3)Average
    1Condition AValueValueValueValue
    2Condition BValueValueValueValue
    3Condition CValueValueValueValue
  • Qualitative Observations: Document observations at different stages of experimentation :

    • Before experiment (experimental setup observations)

    • During experiment (procedural observations)

    • After experiment (result observations)

  • Control for Type I and Type II Errors: Select appropriate statistical methods that balance the risk of false positives and false negatives .

What challenges exist in structural studies of ASA_2267 and how can they be overcome?

Structural studies of ASA_2267, like those of other membrane proteins, present several challenges that require specialized approaches:

  • Protein Solubilization Challenges:
    Membrane proteins require careful extraction from lipid environments. For ASA_2267, consider:

    • Detergent screening (start with DDM, LMNG, or digitonin)

    • Nanodisc incorporation

    • Amphipol stabilization

    • Styrene maleic acid lipid particles (SMALPs)

  • Crystallization Difficulties:
    The hydrophobic nature of membrane proteins complicates crystallization. Strategies include:

    • Lipidic cubic phase (LCP) crystallization

    • Antibody fragment co-crystallization

    • Fusion protein approaches

    • Thermostabilizing mutations

  • Cryo-EM Specific Approaches:
    For ASA_2267 in nanodiscs, the following workflow has proven successful :

    a) Sample optimization:

    • Use tight nanodiscs (scaffold protein ~10Å from membrane protein)

    • Focus on particle cleanup through iterative classification

    b) Data processing protocol:

    • Multi-class ab initio classification followed by:

    • Multiple rounds of heterogeneous refinement (1 good model + 2 "junk" models)

    • Non-uniform refinement on selected particles

    • Local refinement with or without signal subtraction

    This approach has demonstrated improvement from initial 5.5Å to 4.6Å resolution, with continued improvement possible through additional rounds .

  • Computational Approaches:
    Recent advances in computational methods can overcome experimental limitations:

    • AlphaFold2 and similar deep learning tools for initial structure prediction

    • Molecular dynamics simulations in explicit membrane environments

    • Advanced sampling techniques for conformational exploration

  • Functional Reconstitution:
    To validate structural findings, reconstitution into functional assays is essential:

    • Liposome reconstitution

    • Planar lipid bilayers

    • Cell-based functional assays

How might ASA_2267 contribute to antimicrobial resistance mechanisms in A. salmonicida?

While the specific role of ASA_2267 in antimicrobial resistance (AMR) hasn't been directly established, research on A. salmonicida provides context for investigating potential connections:

  • AMR in A. salmonicida Context:
    AMR in A. salmonicida was first reported in 1967 in the USA and has since become a significant concern . The bacterium has developed resistance to multiple antibiotic classes used in aquaculture:

    • β-lactams

    • Tetracyclines

    • Quinolones

    • Florfenicols

    • Folate-pathway inhibitors

  • Resistance Mechanisms:
    Several mechanisms of resistance have been identified in A. salmonicida that ASA_2267 could potentially participate in:

    a) Efflux Pump Systems:

    • As a membrane protein, ASA_2267 might be involved in efflux pump complexes

    • Resistance-nodulation-cell division (RND) family efflux pumps contribute to quinolone resistance

    • Experimental approach: Conduct inhibitor studies with compounds like PAβN to assess efflux activity changes

    b) Membrane Permeability:

    • Membrane proteins can alter cell envelope permeability

    • Changed permeability could reduce intracellular antibiotic concentrations

    • Experimental approach: Fluorescent probe accumulation assays comparing wild-type vs. ASA_2267 deletion mutants

    c) Signaling and Regulation:

    • Membrane proteins often function in signal transduction

    • ASA_2267 could potentially regulate expression of resistance genes

    • Experimental approach: Transcriptomics comparing expression under antibiotic stress

  • Distribution of Resistance:
    Regional variations in resistance profiles suggest environmental adaptations:

    AntibioticRegionMIC50 (mg/L)% Resistant IsolatesSource
    Oxolinic acidFrance1-2High prevalenceBaron et al., 2021
    Oxolinic acidOther regions<0.0625Lower prevalenceInternational standard
    SulfonamidesMultiple regions>25672-92%Various studies
    Trimethoprim+SulfadiazineFranceVariable trimodal22% highly resistantRecent study
  • Genetic Elements of Resistance:
    ASA_2267 should be studied in relation to known genetic determinants:

    • Plasmid-encoded resistance genes (e.g., tetA to tetE)

    • Mutations in QRDRs of DNA gyrase and topoisomerase IV

    • Plasmid-mediated quinolone resistance (PMQR) genes

What computational approaches can advance our understanding of ASA_2267 structure-function relationships?

Recent advances in computational methods offer powerful approaches to study ASA_2267:

  • Deep Learning Structure Prediction:
    The recent paradigm shift in protein structure prediction can be applied to ASA_2267:

    • AlphaFold2 and RoseTTAFold provide highly accurate structure predictions

    • ColabFold offers accessible implementations for academic researchers

    • For membrane proteins, specialized versions like AlphaFold-Multimer with membrane environment considerations are recommended

  • Membrane-Specific Energy Functions:
    Advanced energy functions that account for the membrane environment improve modeling accuracy:

    • Implicit membrane models with depth-dependent dielectric constants

    • Explicit all-atom membrane simulations with appropriate lipid compositions

    • Hybrid models that balance computational efficiency and accuracy

  • Molecular Dynamics Simulations:
    For functional insights, molecular dynamics offers powerful approaches:

    • All-atom simulations in explicit lipid bilayers (DOPC, POPE/POPG for bacterial membranes)

    • Coarse-grained simulations for longer timescales and larger systems

    • Enhanced sampling methods (metadynamics, umbrella sampling) for rare conformational events

  • Machine Learning Integration:
    Beyond structure prediction, machine learning can:

    • Predict binding sites and partners

    • Identify functional motifs through comparison with characterized membrane proteins

    • Suggest experimental mutations to test computational hypotheses

  • Experimental Validation Framework:
    Computational predictions should be validated through:

    • Site-directed mutagenesis of predicted functional residues

    • Cross-linking studies guided by interaction predictions

    • Spectroscopic measurements to verify structural elements

    • Functional assays to confirm computational hypotheses

What are the methodological considerations for nanodisc incorporation of ASA_2267 for structural studies?

Nanodisc incorporation represents a powerful approach for structural studies of ASA_2267, providing a native-like membrane environment without detergent micelles. Key methodological considerations include:

  • Tight Nanodisc Considerations:
    For ASA_2267, tight nanodiscs (where scaffold protein is ~10Å from membrane protein) can be advantageous but present specific challenges :

    • Benefits: Increased protein stability, reduced conformational heterogeneity

    • Challenges: Potential constraints on protein conformation, decreased resolution of scaffold region

    • Solution: Focus refinement specifically on the protein component rather than the entire nanodisc

  • Quality Control Metrics:
    Establish clear quality criteria for successfully incorporated ASA_2267:

    • SEC profile showing monodisperse peak at appropriate molecular weight

    • Negative-stain EM showing homogeneous particles

    • Dynamic light scattering confirming size distribution

    • Functional assays (if available) to confirm native-like behavior

  • Troubleshooting Common Issues:

    IssuePotential CauseSolution
    AggregationInsufficient detergentIncrease detergent concentration during solubilization
    Empty nanodiscsProtein:MSP ratio too lowIncrease protein concentration or decrease MSP
    Multiple proteins per discProtein:MSP ratio too highDecrease protein concentration or increase MSP
    Poor resolution in cryo-EMDataset heterogeneityImplement aggressive particle cleaning as described above

How can researchers design experiments to elucidate the potential role of ASA_2267 in A. salmonicida virulence?

While the specific role of ASA_2267 in virulence hasn't been established, methodological approaches can be designed to investigate this question:

  • Phenotypic Characterization:
    Compare ASA_2267 knockout vs. wild-type in relevant assays:

    PhenotypeAssay MethodConnection to Virulence
    Growth rateGrowth curves at different temperaturesAbility to proliferate in host
    Biofilm formationCrystal violet stainingPersistence in environment
    Stress resistanceSurvival after oxidative/antimicrobial challengesHost defense evasion
    Adhesion to cell linesAttachment to fish cell culturesInitial colonization
    Toxin productionELISA for known A. salmonicida toxinsDirect tissue damage
    Gene expressionRNA-seq of virulence genesRegulatory effects
  • Host-Pathogen Interaction Analysis:

    a) Transcriptomic Response:

    • RNA-seq comparing host response to wild-type vs. ASA_2267 knockout

    • Focus on immune response pathways and tissue damage markers

    b) Protein Interaction Studies:

    • Pull-down assays with tagged ASA_2267

    • Yeast two-hybrid screening against host protein libraries

    • Cross-linking mass spectrometry to identify interaction partners

  • Structural-Functional Analysis:

    a) Site-Directed Mutagenesis:

    • Identify conserved domains or residues in ASA_2267

    • Create point mutations in complemented strains

    • Test mutants in virulence assays to identify crucial regions

    b) Localization Studies:

    • Fluorescent protein fusions to track ASA_2267 during infection

    • Immunogold labeling with electron microscopy

    • Membrane fractionation to confirm localization

  • Experimental Controls and Statistical Analysis:

    • Include appropriate controls (empty vector, unrelated gene knockout)

    • Perform adequate biological replicates (n≥3)

    • Apply appropriate statistical tests based on data distribution

    • Calculate effect sizes to determine biological significance beyond statistical significance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.