Recombinant Aethionema cordifolium Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-322
Protein Length
Full Length of Mature Protein
Species
Aethionema cordifolium (Lebanon stonecress)
Target Names
petA
Target Protein Sequence
NAYPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVKIPYDMQLK QVLANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPV PGQKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGI ISKILRKEKGGYEITIADASNGRQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQ GDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and its role in photosynthetic electron transport?

Apocytochrome f refers to the precursor form of cytochrome f before heme attachment. In Aethionema cordifolium, the mature protein spans amino acids 36-322 of the full protein sequence and functions as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain . The protein is encoded by the chloroplast petA gene and plays an essential role in transferring electrons between photosystem II and photosystem I during photosynthesis .

The functional form of cytochrome f contains a covalently attached c-type heme group, which is critical for its electron transfer capability. The biosynthesis of functional cytochrome f involves a multistep process requiring both processing of the precursor protein and covalent ligation of a c-heme upon membrane insertion . This process is fundamental to the assembly of the photosynthetic apparatus in Aethionema cordifolium.

What expression systems are available for recombinant production of Aethionema cordifolium Apocytochrome f?

Multiple expression systems have been developed for the production of recombinant Aethionema cordifolium Apocytochrome f, each with distinct advantages:

Expression SystemFeaturesApplications
Escherichia coliHigh yield, cost-effective, N-terminal His tag optionStructural studies, antibody production
YeastPost-translational modifications, higher eukaryotic systemFunctional studies requiring proper folding
BaculovirusInsect cell expression, complex modificationsStudies requiring native-like protein structure

E. coli remains the most commonly used system due to its simplicity and high yield. The recombinant protein is typically expressed with an N-terminal His tag and can be purified using metal affinity chromatography . For specialized applications, the protein can also be produced with an Avi-tag for biotinylation, which enables specific binding to streptavidin for immobilization or detection purposes .

How should recombinant Aethionema cordifolium Apocytochrome f be stored and handled?

Proper storage and handling of recombinant Aethionema cordifolium Apocytochrome f is critical for maintaining its stability and functionality. The protein is typically supplied as a lyophilized powder that requires reconstitution before use . For optimal results, follow these guidelines:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

The recommended storage buffer is Tris/PBS-based with 6% Trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles . Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity.

How does protein processing and heme attachment mechanism work for Apocytochrome f?

The biosynthesis of functional cytochrome f involves a sophisticated process of protein maturation and heme attachment. Research using site-directed mutagenesis has revealed several important aspects of this process:

  • Processing of pre-apocytochrome f and heme attachment are distinct events that can occur independently

  • Heme binding is not a prerequisite for cytochrome f processing

  • The consensus cleavage site for the thylakoid processing peptidase (typically AQA) can be modified, resulting in delayed processing but not preventing heme binding

  • Pre-apocytochrome f adopts a suitable conformation for cysteinyl residues to be substrates of the heme lyase even before processing

  • The C-terminal membrane anchor down-regulates the rate of synthesis of cytochrome f

  • Degradation of misfolded forms of cytochrome f occurs via a proteolytic system associated with thylakoid membranes

This understanding of the interplay between protein processing and heme attachment is crucial for researchers working with recombinant forms of the protein, as it explains why expressing the protein without the proper cellular machinery for heme attachment results in the apo-form.

What analytical techniques are most effective for studying recombinant Aethionema cordifolium Apocytochrome f?

Several analytical techniques are particularly valuable for characterizing recombinant Aethionema cordifolium Apocytochrome f:

TechniqueApplicationInformation Obtained
SDS-PAGEPurity assessmentProtein purity, molecular weight verification (>90% purity standard)
Western blottingProtein detectionIdentity confirmation, expression level assessment
Circular dichroismStructural analysisSecondary structure content, folding assessment
Mass spectrometryPrecise mass determinationConfirmation of modifications, sequence verification
NMR spectroscopyStructural characterizationDetailed structural information in solution
UV-visible spectroscopyHeme status assessmentConfirmation of heme incorporation in reconstituted systems

For researchers studying cannabinoid biosynthesis or other secondary metabolites, 1H NMR-based metabolomics has been successfully applied for monitoring metabolite production . While this application is not directly related to Apocytochrome f, the analytical approach might be adaptable for studying protein-metabolite interactions.

How can site-directed mutagenesis be applied to study functional domains of Apocytochrome f?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Apocytochrome f. Based on studies with cytochrome f from Chlamydomonas reinhardtii, several strategies can be applied to Aethionema cordifolium Apocytochrome f:

  • Substitution of cysteinyl residues responsible for heme ligation (e.g., replacing with valine and leucine) to study the role of heme in protein folding and stability

  • Modification of the consensus cleavage site for thylakoid processing peptidase to investigate processing requirements

  • Creation of truncated versions lacking the C-terminal membrane anchor to study membrane insertion dynamics

  • Mutation of residues in the electron transfer pathway to identify critical amino acids for function

Such mutations can be introduced into the petA gene through chloroplast transformation techniques or expressed in heterologous systems. The resulting mutant proteins can be analyzed for changes in processing, heme binding, complex assembly, and electron transfer capability.

What are the considerations for experimental design when studying protein-protein interactions involving Apocytochrome f?

When investigating protein-protein interactions involving Apocytochrome f, several critical considerations should guide experimental design:

  • Protein state selection: Determine whether to use the apo-form (without heme) or reconstituted holo-form, depending on the research question

  • Interaction partners: Identify potential interaction partners from the photosynthetic electron transport chain (e.g., plastocyanin, cytochrome b6)

  • Membrane environment: Consider the native membrane environment, as cytochrome f is normally membrane-anchored in vivo

  • Detection methods: Select appropriate methods such as co-immunoprecipitation, yeast two-hybrid, surface plasmon resonance, or chemical cross-linking

  • Controls: Include negative controls (non-interacting proteins) and positive controls (known interaction partners)

For in vitro studies, researchers should consider using recombinant proteins with appropriate tags that facilitate detection without interfering with the interaction. For instance, the Avi-tag biotinylated version of the protein might be useful for pull-down assays .

What challenges might researchers encounter when expressing recombinant Aethionema cordifolium Apocytochrome f?

Researchers working with recombinant Aethionema cordifolium Apocytochrome f may encounter several challenges:

  • Low expression yields: The membrane-associated nature of the native protein can lead to expression difficulties in heterologous systems

  • Protein misfolding: Without the proper machinery for processing and heme attachment, the protein may not fold correctly

  • Inclusion body formation: Overexpression in E. coli often leads to inclusion body formation, requiring denaturation and refolding

  • Lack of post-translational modifications: E. coli lacks the machinery for certain post-translational modifications that might be present in the native protein

  • Protein aggregation: The hydrophobic regions designed for membrane insertion can cause aggregation in aqueous solutions

To address these challenges, researchers can optimize expression conditions (temperature, induction timing, media composition), use specialized E. coli strains designed for membrane protein expression, or consider alternative expression systems like yeast or insect cells for more complex applications .

How can researchers verify the functional integrity of recombinant Aethionema cordifolium Apocytochrome f?

Verifying the functional integrity of recombinant Apocytochrome f is crucial, especially since the recombinant form typically lacks heme. Several approaches can be used:

  • Structural assessment: Secondary structure analysis using circular dichroism to confirm proper folding compared to native protein

  • Heme reconstitution assays: In vitro reconstitution with heme followed by spectroscopic analysis to confirm binding

  • Binding assays with interaction partners: Evaluate binding to known interaction partners such as plastocyanin

  • Electron transfer capability: For reconstituted holo-protein, measure electron transfer rates using spectroelectrochemical methods

  • Assembly into protein complexes: Assess ability to incorporate into cytochrome b6f complexes in reconstitution experiments

Researchers should note that while the apo-form lacks heme, studies have shown that pre-apocytochrome f can adopt a suitable conformation for the cysteinyl residues to be substrates of the heme lyase, and pre-holocytochrome f can fold in an assembly-competent conformation .

What strategies can be employed to improve yield and purity of recombinant Aethionema cordifolium Apocytochrome f?

Several optimization strategies can significantly improve the yield and purity of recombinant Aethionema cordifolium Apocytochrome f:

StrategyApproachExpected Outcome
Expression optimizationLower induction temperature (16-20°C)Reduced inclusion body formation, improved solubility
Solubility enhancementFusion with solubility tags (MBP, SUMO)Increased soluble fraction, reduced aggregation
Media optimizationEnriched media, osmotic stress agentsEnhanced expression yields
Purification refinementTwo-step chromatography (IMAC followed by SEC)Higher purity (>95%)
Buffer optimizationScreening buffer compositions with stabilizing agentsImproved protein stability during purification
Codon optimizationAdapting codon usage to expression hostEnhanced translation efficiency

When working with the His-tagged version, researchers should optimize imidazole concentrations during purification to maximize yield while maintaining purity. For long-term storage, including 6% trehalose in the buffer has been shown to enhance stability .

How can recombinant Aethionema cordifolium Apocytochrome f be used in photosynthesis research?

Recombinant Aethionema cordifolium Apocytochrome f serves as a valuable tool in various aspects of photosynthesis research:

  • Structural studies: The purified protein can be used for crystallographic or NMR studies to understand species-specific structural features

  • Comparative biochemistry: Comparing properties with cytochrome f from other species can reveal evolutionary adaptations

  • Electron transport models: The protein can be incorporated into reconstituted systems to study electron transport mechanics

  • Antibody production: Generating antibodies against the recombinant protein for immunolocalization studies

  • Protein-protein interaction mapping: Identifying interaction partners within the photosynthetic apparatus

Given that Aethionema cordifolium (Lebanese Cress) functions as an excellent oxygenator and has edible leaves that can be added to salads , research on its photosynthetic proteins may also provide insights into its adaptive mechanisms for growth in moist soil to shallow water environments.

What future research directions might involve Aethionema cordifolium Apocytochrome f?

Several promising research directions could advance our understanding of Aethionema cordifolium Apocytochrome f and its role in photosynthesis:

  • Comparative genomics: Analyzing the petA gene and its regulatory elements across Brassicaceae family members to understand evolutionary relationships

  • Climate adaptation mechanisms: Investigating how cytochrome f structure and function contribute to Aethionema cordifolium's adaptation to specific environmental conditions

  • Synthetic biology applications: Using the protein as a component in engineered electron transport chains for bioenergy applications

  • Structure-guided protein engineering: Modifying the protein to enhance electron transfer efficiency or stability

  • Systems biology integration: Placing cytochrome f function within the broader context of metabolic networks in Aethionema cordifolium

With the growing interest in plant metabolomics and proteomics for studying secondary metabolite production, the methodologies developed for Cannabis research could potentially be adapted to study how environmental factors influence photosynthetic protein expression in Aethionema cordifolium.

What are the best practices for reconstituting lyophilized recombinant Aethionema cordifolium Apocytochrome f?

Proper reconstitution of lyophilized recombinant Aethionema cordifolium Apocytochrome f is critical for maintaining protein integrity. Follow this detailed protocol:

  • Equilibrate the lyophilized protein vial to room temperature before opening

  • Centrifuge the vial briefly (30 seconds at 10,000 × g) to collect all material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, adding the water gently along the sides of the vial

  • Allow complete dissolution by gentle rotation or inversion (avoid vortexing which can cause denaturation)

  • For long-term storage, add glycerol to a final concentration of 50%

  • Divide into small working aliquots (20-50 µL) to minimize freeze-thaw cycles

  • Flash-freeze aliquots in liquid nitrogen before transferring to -80°C storage

This protocol maximizes protein stability and minimizes aggregation or denaturation during the reconstitution process.

How can researchers distinguish between recombinant Apocytochrome f and the holo-form in experimental systems?

Distinguishing between the apo-form (Apocytochrome f) and holo-form (mature Cytochrome f with heme) is important in many experimental contexts. Several methods can be employed:

  • UV-visible spectroscopy: Holo-cytochrome f shows characteristic absorption peaks at approximately 420 nm (Soret band) and 520-550 nm (α/β bands) in the reduced state, which are absent in apocytochrome f

  • SDS-PAGE mobility: Holo-cytochrome f often shows slightly different migration patterns compared to apocytochrome f due to the presence of the heme group

  • Heme staining: Techniques such as TMBZ (3,3',5,5'-tetramethylbenzidine) staining can specifically detect heme-containing proteins on gels

  • Peroxidase activity: Holo-cytochrome f exhibits peroxidase-like activity due to the heme group, which can be detected using appropriate substrates

  • Mass spectrometry: The mass difference between apo and holo forms (approximately the mass of heme, ~616 Da) can be detected by precise mass determination

These methods can be used individually or in combination to confirm the presence or absence of heme in experimental preparations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.