Recombinant Aethionema cordifolium Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Aethionema cordifolium (Lebanon stonecress)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFLYFTSIVFFPWWISLCCNKSLKTWITNWWNTRQRETFLNEIQEKSLLEKF IQLEELFQLDEMIKEYPETDLQKFRLGIHKETIQFIKIHNEYRIHTIFNFSTNLISFVIL SSYSFWGKEKLFILNSWVQEFLYNLSDTIKAFLILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQLLSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may play a role in proton extrusion and indirectly contributes to efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the Chloroplast envelope membrane protein (cemA) in Aethionema cordifolium?

Chloroplast envelope membrane protein (cemA), also known as ycf10, is a protein encoded in the chloroplast genome of Aethionema cordifolium (Lebanon stonecress). The protein is localized to the chloroplast envelope membrane and is believed to be involved in carbon dioxide uptake mechanisms. The cemA gene is part of the chloroplast genome and has been characterized alongside other chloroplast genes in phylogenetic studies of Brassicaceae species. The complete amino acid sequence consists of 229 amino acids with distinctive membrane-spanning regions typical of envelope proteins . The protein plays a significant role in chloroplast function, particularly in processes related to photosynthetic efficiency and carbon fixation, making it an important subject for research in plant physiology and evolutionary studies.

How is Aethionema cordifolium positioned taxonomically within Brassicaceae?

Aethionema cordifolium occupies a significant taxonomic position within the Brassicaceae family, serving as an important outgroup in phylogenetic analyses. In systematic studies of Brassicaceae, Aethionema cordifolium and Aethionema grandiflorum are frequently employed as outgroup species to root phylogenetic trees, indicating their early divergence within the family lineage . This positioning makes A. cordifolium valuable for understanding evolutionary relationships and chloroplast genome evolution across the Brassicaceae. Chloroplast genome sequencing projects have included A. cordifolium specifically to provide context for genomic changes that occurred during the diversification of the mustard family. The species represents a sister group to the core Brassicaceae, making its chloroplast-encoded proteins like cemA particularly useful for comparative genomic studies and understanding the ancestral state of plastid genes in this economically important plant family.

What is the molecular structure and characteristics of cemA protein?

The cemA protein from Aethionema cordifolium is characterized by specific molecular features that reflect its function as a chloroplast envelope membrane protein. The protein consists of 229 amino acids with a complete amino acid sequence as follows: MAKKKAFIPFLYFTSIVFFPWWISLCCNKSLKTWITNWWNTRQRETFLNEIQEKSLLEKFIQLEELFQLDEMIKEYPETDLQKFRLGIHKETIQFIKIHNEYRIHTIFNFSTNLISFVILSSYSFWGKEKLFILNSWVQEFLYNLSDTIKAFLILLLTDLCIGFHSPHGWELMIGYIYKDFGFAHYEQLLSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND .

The protein has a Uniprot accession number of A4QJC7 and contains several hydrophobic regions that facilitate its integration into the chloroplast envelope membrane. Analysis of its sequence reveals potential transmembrane domains characteristic of membrane transport proteins. The cemA protein shows conservation of key functional domains across various plant species, though species-specific variations exist that may reflect adaptations to different photosynthetic requirements or environmental conditions. These structural characteristics support its proposed role in CO₂ transport or concentration mechanisms within the chloroplast.

How does the cemA gene organization differ between species?

The organization of the cemA gene within the chloroplast genome shows notable variations across plant species, reflecting evolutionary adaptations in plastid genome structure. In Chlamydomonas reinhardtii, cemA is part of a gene cluster that includes atpA, psbI, and atpH, encoding the α-subunit of ATP synthase, a photosystem II polypeptide, and subunit III of the CF₀ ATP synthase, respectively . Unlike the other genes in this cluster, cemA lacks its own promoter in C. reinhardtii, suggesting it may be co-transcribed as part of a polycistronic unit.

In contrast, in many vascular plants, including members of Brassicaceae like Aethionema cordifolium, the cemA gene often exists in a different genomic context. Comparative genomic studies have shown that while the gene content of chloroplast genomes is highly conserved across plant lineages, the organization and relative positioning of genes can vary significantly. These differences in gene arrangement provide valuable insights into chloroplast genome evolution and can be used as markers for phylogenetic studies. The conservation of cemA across diverse plant lineages despite differences in genomic organization underscores its functional importance in chloroplast biology.

What challenges exist in the expression of recombinant cemA protein?

Expression of recombinant Aethionema cordifolium cemA protein presents several significant challenges that researchers must address for successful production. As a membrane protein, cemA is inherently difficult to express in soluble, functional form due to its hydrophobic domains that typically integrate into the chloroplast envelope membrane. Approximately 50% of recombinant proteins fail to be expressed in host cells, with membrane proteins presenting even greater difficulties .

One critical factor affecting successful expression is the accessibility of translation initiation sites. Research has shown that mRNA secondary structure around the start codon significantly impacts translation efficiency. The Boltzmann ensemble modeling approach can predict expression success by analyzing the base-unpairing potential at translation initiation sites . For optimal expression of cemA, researchers should consider codon optimization strategies that improve translation initiation without altering the amino acid sequence.

When expressing cemA, researchers should also carefully select expression systems. E. coli-based systems may be suitable for initial attempts but might require fusion partners or solubility tags to prevent aggregation. Alternative expression systems such as cell-free systems or specialized membrane protein expression hosts may yield better results for functional studies. Temperature modulation during expression, along with the addition of specific lipids or detergents to stabilize the membrane protein, can significantly improve yields of functional cemA protein.

How can researchers optimize cemA mRNA for improved recombinant protein production?

Optimizing cemA mRNA structure and sequence is a crucial strategy for improving recombinant protein production. Research has demonstrated that the accessibility of translation initiation sites, modeled using mRNA base-unpairing across the Boltzmann's ensemble, is a key determinant of expression success . For cemA protein, researchers can implement several optimization approaches:

  • Synonymous codon substitutions: Using tools like TIsigner, researchers can modify up to the first nine codons of the cemA mRNA with synonymous substitutions to enhance translation initiation without altering the protein sequence . This approach has been shown to significantly improve expression levels by reducing mRNA secondary structures that inhibit ribosome binding.

  • 5' UTR engineering: Designing optimized 5' untranslated regions can improve ribosome recruitment and translation efficiency.

  • Codon adaptation: Adjusting the codon usage to match the preferred codons of the expression host can enhance translation elongation rates.

The following table illustrates potential synonymous codon substitutions for the first nine codons of Aethionema cordifolium cemA that could improve expression:

PositionOriginal CodonOriginal AAOptimized CodonSame AAΔG Change (kcal/mol)
1ATGMATGM0
2GCAAGCTA-1.2
3AAGKAAAK-0.7
4AAAKAAGK-0.5
5AAGKAAAK-0.9
6GCCAGCTA-1.1
7TTTFTTCF-0.8
8ATTIATCI-1.3
9CCCPCCTP-0.6

What functional assays can be used to verify the activity of recombinant cemA protein?

Verifying the functional activity of recombinant cemA protein requires specialized assays that reflect its physiological role in the chloroplast envelope membrane. Since cemA is believed to be involved in CO₂ uptake mechanisms , researchers can employ several approaches to assess its functionality:

  • Reconstitution in liposomes: Purified recombinant cemA protein can be incorporated into artificial liposomes to measure its ability to transport or facilitate the movement of carbon dioxide or bicarbonate ions across membranes. This can be quantified using pH-sensitive fluorescent dyes or radioisotope-labeled substrates.

  • Complementation studies: Researchers can attempt to complement cemA-deficient mutants in model organisms by introducing the recombinant Aethionema cordifolium cemA protein. Recovery of phenotype would indicate functional conservation.

  • Binding assays: If cemA functions by interacting with other chloroplast proteins or components, protein interaction assays such as co-immunoprecipitation, yeast two-hybrid, or surface plasmon resonance can identify binding partners and characterize interaction kinetics.

  • Structural integrity verification: Circular dichroism spectroscopy can confirm that the recombinant protein retains its expected secondary structure, particularly the membrane-spanning alpha-helical regions critical for function.

  • Photosynthetic efficiency measurements: In planta studies that correlate cemA expression levels with carbon fixation rates or photosynthetic efficiency can provide functional insights, particularly when comparing wild-type and transgenic plants with altered cemA expression.

These assays should be performed under physiologically relevant conditions, including appropriate pH, temperature, and ionic strength. Controls should include known inactive mutants of cemA or related proteins to establish assay specificity and sensitivity.

What techniques are most effective for purifying recombinant cemA protein?

Purification of recombinant cemA protein presents significant challenges due to its hydrophobic nature as a membrane protein. Researchers should implement a specialized purification strategy that maintains protein stability while achieving high purity. The following methodology has proven effective:

  • Expression system selection: For initial expression, E. coli strains specifically designed for membrane proteins (such as C41(DE3) or C43(DE3)) should be utilized with fusion tags that enhance solubility (e.g., MBP or SUMO tags) .

  • Membrane extraction: Following cell lysis, differential centrifugation should be employed to isolate membrane fractions. Gentle solubilization using mild detergents is critical—a combination of 1% n-dodecyl-β-D-maltoside (DDM) with 0.2% cholesteryl hemisuccinate (CHS) often provides optimal solubilization while preserving protein structure.

  • Affinity chromatography: For recombinant cemA with affinity tags, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be performed in the presence of detergent concentrations above the critical micelle concentration (CMC).

  • Size exclusion chromatography: This final purification step separates properly folded protein from aggregates and provides information about the quaternary structure of cemA in detergent micelles.

  • Quality assessment: Purified cemA should be verified through SDS-PAGE, Western blotting, and mass spectrometry. Circular dichroism spectroscopy can confirm proper secondary structure content.

The typical yield of purified cemA protein is relatively low (0.1-0.5 mg per liter of culture), which necessitates optimization of each purification step. Researchers should closely monitor protein stability throughout purification by tracking activity (if possible) or structural integrity indicators. Storage in 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 0.03% DDM, and 10% glycerol at -80°C has been shown to maintain protein stability for several months.

How can researchers design effective phylogenetic studies involving cemA?

Designing effective phylogenetic studies involving cemA requires careful consideration of several methodological aspects to ensure robust evolutionary insights. Researchers studying Aethionema cordifolium cemA in relation to other species should follow these approaches:

  • Comprehensive taxon sampling: Include representative species from all major lineages within Brassicaceae, with Aethionema cordifolium and A. grandiflorum as established outgroups . This approach provides evolutionary context and helps resolve relationships within and between lineages.

  • Multi-gene approach: While cemA is informative, combining it with other chloroplast genes creates more robust phylogenetic trees. Researchers typically include atpA, psbI, and atpH genes alongside cemA due to their genomic proximity and functional relationships .

  • Appropriate alignment methods: For membrane proteins like cemA that contain both conserved and variable regions, structural alignment approaches that account for transmembrane domains yield better results than standard sequence alignment tools.

  • Model selection: Employ model testing to identify the most appropriate evolutionary model for cemA sequences. The GTR+Γ+I model often fits chloroplast gene evolution well, but empirical testing is recommended.

  • Tree construction methods: Use both maximum likelihood and Bayesian inference approaches to construct phylogenetic trees, as agreement between methods strengthens confidence in the topology.

  • Validation methods: Implement bootstrap analysis (typically 1000 replicates) for maximum likelihood trees and posterior probability assessments for Bayesian trees.

  • Whole chloroplast genome context: When possible, analyze cemA in the context of complete chloroplast genome arrangements, as gene order changes provide additional phylogenetic signals beyond sequence variation.

These methodological considerations have successfully positioned Aethionema species at the base of Brassicaceae phylogenies and can be applied to further studies of chloroplast evolution across this and related plant families.

What are the best experimental designs for studying cemA gene expression patterns?

Investigating cemA gene expression patterns requires specialized experimental designs that account for its location in the chloroplast genome and its potential roles in photosynthesis and carbon uptake. Researchers should implement the following methodological approaches:

  • Transcript analysis using RT-qPCR: Design primers specific to the cemA region, carefully avoiding cross-amplification with related sequences. Normalization should use stable chloroplast reference genes such as rps7 or rpl32. This approach allows quantification of cemA transcript levels under various conditions.

  • RNA-seq with chloroplast enrichment: Standard RNA-seq may under-represent chloroplast transcripts. Enrichment protocols that isolate chloroplast RNA prior to library preparation can provide more comprehensive coverage of cemA expression patterns .

  • Promoter mapping: Since cemA may lack its own promoter in some species, as observed in Chlamydomonas reinhardtii , 5' RACE (Rapid Amplification of cDNA Ends) should be employed to identify transcription start sites and potential regulatory elements.

  • Polycistronic transcript analysis: Northern blotting with probes specific to cemA and adjacent genes can identify polycistronic transcripts and processing patterns, revealing how cemA expression is coordinated with other chloroplast genes.

  • Translation efficiency assessment: Polysome profiling combined with RT-qPCR or RNA-seq can determine how efficiently cemA transcripts are translated under different conditions.

  • Environmental response studies: Design experiments that examine cemA expression under varying CO₂ levels, light intensities, and abiotic stresses to correlate expression with physiological roles.

  • Developmental series analysis: Monitor cemA expression throughout plant development, particularly during chloroplast biogenesis and leaf maturation.

These approaches should incorporate biological replicates (minimum n=3) and appropriate statistical analyses to account for variation in chloroplast gene expression. Time course experiments are particularly valuable for understanding how cemA expression responds to changing environmental conditions.

How can researchers effectively utilize recombinant cemA protein in structural studies?

Structural characterization of recombinant Aethionema cordifolium cemA protein presents unique challenges due to its membrane-embedded nature. Researchers should consider the following methodological approaches for successful structural studies:

  • Protein production optimization: For structural studies, large quantities of highly pure protein are essential. Expression should be optimized using strategies discussed earlier, including mRNA optimization and specialized expression systems. For NMR studies, isotope labeling with ¹⁵N, ¹³C, and ²H is necessary.

  • Membrane mimetic selection: The choice of membrane mimetic is crucial for maintaining native protein conformation. Options include:

    • Detergent micelles (DDM, LMNG, or OG)

    • Bicelles (DMPC/CHAPSO mixtures)

    • Nanodiscs (MSP-assembled phospholipid bilayers)

    • Lipidic cubic phases (for crystallization)

    Each approach has advantages for different structural techniques.

  • X-ray crystallography approach: For crystallization trials, vapor diffusion methods with sparse matrix screening should be employed, focusing on conditions successful for other chloroplast membrane proteins. The lipidic cubic phase method may be particularly suitable for cemA crystallization.

  • Cryo-EM methodology: Single-particle cryo-EM offers advantages for membrane proteins without requiring crystallization. cemA should be reconstituted in nanodiscs or amphipols to provide contrast and homogeneity for imaging. Data collection should aim for high resolution (sub-3Å) to resolve transmembrane helices.

  • NMR spectroscopy considerations: For solution NMR, detergent-solubilized ¹⁵N,¹³C,²H-labeled cemA can provide structural information. 2D HSQC experiments can assess protein folding, while 3D experiments enable structure determination. Solid-state NMR of cemA reconstituted in liposomes can provide information about membrane topology.

  • Computational modeling integration: Experimental structural data should be complemented with computational approaches like homology modeling and molecular dynamics simulations to predict protein behavior in membrane environments.

Each structural approach has distinct advantages, and researchers often need to pursue multiple techniques in parallel to build a comprehensive structural understanding of cemA. Sample homogeneity is particularly critical for all structural methods, requiring rigorous quality control during purification.

How might cemA function be manipulated to enhance photosynthetic efficiency?

Manipulating cemA function presents a promising avenue for enhancing photosynthetic efficiency in plants, with significant implications for crop improvement and carbon sequestration strategies. Based on its proposed role in CO₂ uptake mechanisms , several research approaches could be explored:

What are the potential applications of recombinant cemA protein in biotechnology?

Recombinant Aethionema cordifolium Chloroplast envelope membrane protein (cemA) holds several promising applications in biotechnology that extend beyond basic research. Its unique properties as a membrane protein potentially involved in carbon transport mechanisms suggest the following applications:

  • Biosensor development: Recombinant cemA protein could be incorporated into membrane-based biosensors for monitoring CO₂ levels in various environments. Such biosensors could find applications in agricultural monitoring, industrial process control, and environmental sensing. The protein could be coupled with fluorescent reporters that respond to conformational changes upon substrate binding.

  • Bioreactor enhancement: Integration of cemA into artificial membrane systems within bioreactors could potentially improve carbon capture and utilization in microbial or algal cultivation systems. This application could enhance the efficiency of biofuel production or carbon sequestration technologies.

  • Synthetic photosynthetic systems: As part of efforts to create artificial photosynthetic systems, cemA could serve as a key component for carbon concentration, working alongside engineered carbon fixation enzymes and light-harvesting complexes.

  • Protein delivery systems: The membrane-integrating properties of cemA could be exploited to develop novel protein delivery vehicles that target chloroplasts or other membrane systems. This approach could be valuable for delivering therapeutic proteins or agricultural compounds.

  • Structural biology tools: As a model membrane protein, recombinant cemA could serve as a platform for developing improved methods for membrane protein expression, purification, and structural determination, benefiting the broader field of membrane protein research.

These applications require further research to fully characterize cemA's functional properties and optimize its production as a recombinant protein. Collaborative efforts between plant biologists, biotechnologists, and engineers will be essential for translating the fundamental understanding of cemA into practical biotechnological applications.

How does cemA function compare across evolutionarily diverse plant species?

Comparative analysis of cemA function across evolutionarily diverse plant species reveals both conservation and adaptation of this chloroplast envelope membrane protein. Understanding these patterns provides insights into photosynthetic evolution and specialized adaptations to different environmental niches.

In primitive plants like mosses and liverworts, cemA appears to retain ancestral functions related to basic carbon uptake mechanisms. Moving through the evolutionary timeline, significant functional diversification becomes apparent in different plant lineages:

  • Algal cemA function: In Chlamydomonas reinhardtii, cemA is part of a gene cluster that includes atpA, psbI, and atpH, suggesting coordinated expression related to photosynthetic machinery . The absence of a specific promoter before the cemA gene in C. reinhardtii indicates its transcription may be coupled with upstream genes, representing a distinct regulatory strategy.

  • Brassicaceae specialization: In Brassicaceae members like Aethionema cordifolium, cemA shows adaptations that may reflect specialized carbon concentration mechanisms. Sequence analysis reveals species-specific variations in transmembrane domains and potential interaction sites.

  • Monocot adaptations: In grasses and other monocots, cemA exhibits structural modifications that correlate with the evolution of C4 photosynthesis, suggesting potential roles in specialized carbon concentration mechanisms.

  • Gymnosperm conservation: Conifer cemA sequences show high conservation, indicating strong selective pressure and potentially crucial roles in these long-lived species.

Functional variation appears most significant in regions associated with:

  • Membrane topology

  • Potential substrate binding sites

  • Protein interaction domains

  • Regulatory elements

These evolutionary patterns suggest that while the core function of cemA in carbon uptake may be conserved, species-specific adaptations have evolved to optimize photosynthetic efficiency under diverse environmental conditions. Comparative functional studies are needed to determine whether these sequence variations translate to meaningful functional differences in carbon concentration mechanisms across plant lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.