Recombinant Aethionema cordifolium NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Aethionema cordifolium (Lebanon stonecress)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSAIPFLAFLISGILSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the enzyme's primary electron acceptor. NDH couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 and what is its role in chloroplasts?

NAD(P)H-quinone oxidoreductase (NQOR) is a key enzyme in electron transport chains that catalyzes the reduction of quinones, azo dyes, and other electron acceptors using either NADPH or NADH as electron donors. The subunit 3 found in chloroplasts plays a critical role in photosynthetic electron transport. In chloroplasts, this enzyme functions within the thylakoid membrane to facilitate electron transfer between membrane complexes, contributing to ATP synthesis and redox homeostasis in the organelle. Similar to other NAD(P)H oxidoreductases, it likely functions as part of a homodimeric or oligomeric complex where subunit interactions are crucial for optimal catalytic activity . Understanding this enzyme is essential for comprehending the fundamental mechanisms of photosynthetic energy conversion in Aethionema cordifolium, a plant species that has adapted to specific environmental conditions.

How does the Aethionema cordifolium variant compare to homologs in other species?

The Aethionema cordifolium variant of NAD(P)H-quinone oxidoreductase subunit 3 shares structural and functional similarities with homologs from other plant species, but with species-specific differences that may reflect evolutionary adaptations. From comparative analyses of similar enzymes, we know that even single amino acid differences can significantly alter substrate specificity and catalytic efficiency . For example, in NAD(P)H:quinone oxidoreductase from rats, humans, and mice, a single amino acid substitution (Tyr-104 to Gln) causes the rat enzyme to behave differently from the human and mouse enzymes in terms of substrate reduction rates .

The Aethionema cordifolium variant likely contains unique structural features that distinguish it from other species' homologs, particularly in regions that interact with the FAD cofactor and substrate binding sites. These differences would be reflected in its kinetic parameters and substrate preferences, making comparative studies valuable for understanding structure-function relationships across species.

What are the general structural characteristics of NAD(P)H-quinone oxidoreductases?

The isoalloxazine ring of FAD plays a critical role in the enzyme's function, accepting hydride from NAD(P)H and transferring it to quinone substrates. The degree of bending or flexibility in the isoalloxazine ring can vary between species and affects catalytic efficiency . In human and mouse enzymes, the FAD binding site appears to accommodate some bending of the isoalloxazine around its central axis, while in rat enzymes, a tyrosine residue holds the FAD more rigidly . These structural differences contribute to variations in substrate specificity and reaction rates across species.

What expression systems are optimal for producing recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase?

For expressing recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase subunit 3, several expression systems should be considered based on their advantages for chloroplastic proteins. Escherichia coli expression systems have been successfully used for similar oxidoreductases, as demonstrated in studies of NAD(P)H:quinone oxidoreductase heterodimers . When using E. coli, incorporating a polyhistidine tag facilitates purification through nickel nitrilotriacetate column chromatography under non-denaturing conditions .

For challenging chloroplastic proteins that may require post-translational modifications, plant-based expression systems such as Nicotiana benthamiana or Chlamydomonas reinhardtii might provide better folding environments. The choice of expression system should consider factors such as codon optimization, presence of chloroplast transit peptides, and requirements for disulfide bond formation or other post-translational modifications. A comparative approach testing multiple expression systems is recommended to identify optimal conditions for obtaining functionally active enzyme.

How can I assess the kinetic parameters of the recombinant enzyme with different electron acceptors?

To comprehensively assess the kinetic parameters of recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase with different electron acceptors, a systematic approach should be employed. Based on methodologies used for similar enzymes, you should test both two-electron acceptors (such as 2,6-dichloroindophenol and menadione) and four-electron acceptors (such as methyl red) .

For each substrate, determine the Km and kcat values for both NADPH and NADH as electron donors. This can be done using spectrophotometric assays monitoring the oxidation of NAD(P)H at 340 nm or the reduction of electron acceptors at their characteristic wavelengths. A typical experimental setup would include:

  • Reaction buffer (typically 25 mM Hepes-NaOH pH 7.5-8.0)

  • Variable concentrations of electron acceptors

  • Fixed concentrations of NAD(P)H

  • Purified recombinant enzyme

The resulting data should be analyzed using appropriate enzyme kinetics models (Michaelis-Menten, Lineweaver-Burk, or non-linear regression analysis) to determine Km, kcat, and catalytic efficiency (kcat/Km). From studies with similar enzymes, we know that heterodimeric forms may show different kinetic behaviors with two-electron versus four-electron acceptors, reflecting cooperative interactions between subunits .

What structural changes occur upon substrate binding in NAD(P)H-quinone oxidoreductases?

Structural studies of NAD(P)H-quinone oxidoreductases have revealed significant conformational changes upon substrate binding and release. In human and mouse NAD(P)H:quinone oxidoreductases, comparisons between the apoenzyme (containing only FAD) and enzyme-substrate complexes show distinct structural rearrangements . These changes primarily involve repositioning of amino acid residues in the substrate binding pocket to accommodate the quinone substrate.

The binding of substrates like duroquinone (2,3,5,6-tetramethyl-1,2-benzoquinone) causes specific movements in the active site that optimize electron transfer parameters . The degree of flexibility in the FAD isoalloxazine ring may also change upon substrate binding, affecting the efficiency of hydride transfer. To study these structural changes in the Aethionema cordifolium enzyme, X-ray crystallography of both the apoenzyme and enzyme-substrate complexes would be ideal, complemented by molecular dynamics simulations to capture transient conformational states during catalysis.

Enzyme StateStructural FeaturesFunctional Implications
Apoenzyme (FAD only)More open conformation around substrate binding siteReady to accept NAD(P)H and quinone substrates
NAD(P)H-boundCloser contact between NAD(P)H and FADOptimized for hydride transfer to FAD
Quinone-boundRepositioned active site residuesFacilitates electron transfer from FADH₂ to quinone
Ternary complexMost compact active site configurationProvides optimal geometry for catalysis

How do subunits interact in NAD(P)H-quinone oxidoreductase dimers during catalysis?

The functional interactions between subunits in NAD(P)H-quinone oxidoreductase dimers demonstrate fascinating complexity that varies with substrate type. Research using heterodimers containing one wild-type and one mutant subunit has provided crucial insights into these interactions . With two-electron acceptors like 2,6-dichloroindophenol and menadione, the subunits appear to function independently - the Km values for NADPH and NADH in heterodimers remain similar to those of wild-type homodimers, while the kcat values are approximately 50% of the wild-type value . This suggests that each subunit can independently bind and process these substrates.

What are the best purification methods for recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase?

For purifying recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase subunit 3, a multi-step chromatographic approach is recommended. Based on successful methods for similar enzymes, the following protocol is suggested:

  • Affinity chromatography: If the recombinant protein is expressed with a polyhistidine tag, nickel nitrilotriacetate (Ni-NTA) affinity chromatography under non-denaturing conditions allows for efficient initial purification . Stepwise elution with increasing imidazole concentrations (typically 20-250 mM) can effectively separate the target protein.

  • Ion exchange chromatography: Following affinity purification, ion exchange chromatography (either anion or cation exchange depending on the protein's isoelectric point) can further remove contaminants. For chloroplastic proteins, which often have distinct charge properties, this step is particularly useful.

  • Size exclusion chromatography: A final polishing step using size exclusion chromatography helps obtain homogeneous protein preparations and can provide information about the oligomeric state of the enzyme under native conditions.

Throughout the purification process, maintaining the FAD cofactor association is crucial for enzyme activity. Including low concentrations of FAD (1-10 μM) in purification buffers may prevent cofactor loss. The purity of the enzyme can be assessed using SDS-PAGE, native PAGE, and immunoblot analysis . Activity assays with standard substrates should be performed at each purification step to track functional integrity.

How can I analyze the FAD binding characteristics of the recombinant enzyme?

Analyzing the FAD binding characteristics of recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase requires a combination of spectroscopic, thermodynamic, and structural approaches. The FAD cofactor plays a crucial role in the enzyme's function, with its isoalloxazine ring serving as the electron transfer intermediate between NAD(P)H and quinone substrates .

To characterize FAD binding:

  • UV-visible spectroscopy: The enzyme-bound FAD exhibits characteristic absorption peaks at approximately 375 nm and 450 nm. The shape and intensity of these peaks can provide information about the environment of the FAD within the protein. Monitoring spectral changes during reduction with NAD(P)H can reveal details about electron transfer to the FAD.

  • Fluorescence spectroscopy: FAD fluorescence is typically quenched when bound to proteins. The degree of quenching and changes in fluorescence emission spectra upon substrate binding can provide insights into conformational changes affecting the FAD microenvironment.

  • Isothermal titration calorimetry (ITC): This technique can determine the thermodynamic parameters (ΔH, ΔS, Kd) of FAD binding to the apoenzyme. Comparing these parameters with those of related enzymes can reveal species-specific differences in cofactor interaction.

  • Analysis of FAD-protein interactions: Detailed examination of the crystal structure, if available, can identify specific amino acid residues that interact with the FAD. In human and mouse NAD(P)H:quinone oxidoreductases, the binding site accommodates some bending of the isoalloxazine ring, while in rat enzymes, the FAD is held more rigidly by specific residues like Tyr-104 . Similar analyses of the Aethionema cordifolium enzyme could reveal unique features of its FAD interaction.

What techniques are most effective for studying electron transfer mechanisms in this enzyme?

Investigating electron transfer mechanisms in Aethionema cordifolium NAD(P)H-quinone oxidoreductase requires sophisticated techniques that can capture the rapid redox changes occurring during catalysis. Several complementary approaches should be employed:

  • Stopped-flow spectroscopy: This technique allows for monitoring rapid changes in absorbance associated with redox transitions of FAD and substrate molecules on millisecond timescales. By following the reduction of FAD by NAD(P)H and subsequent reoxidation by quinone substrates, the kinetics of individual electron transfer steps can be determined.

  • NADPH fluorescence measurements: As described in the research on chloroplast preparations, NADPH fluorescence can be monitored using specialized equipment such as a Dual-PAM with an NADPH/99-A module . This approach allows for real-time tracking of NADPH oxidation during enzyme activity. Typical experimental setups involve measuring fluorescence in dark-adapted samples followed by actinic illumination to trigger electron transfer reactions .

  • Electron paramagnetic resonance (EPR) spectroscopy: For detecting and characterizing radical intermediates during catalysis, EPR spectroscopy is invaluable. This technique can provide information about the electronic structure of radical species and their interactions with the enzyme environment.

  • Redox potential measurements: Determining the redox potentials of the FAD cofactor and various substrates can provide thermodynamic insights into the feasibility and directionality of electron transfer reactions. Techniques such as protein film voltammetry allow for direct measurement of enzyme redox properties on electrode surfaces.

  • Site-directed mutagenesis combined with kinetic analysis: By systematically altering amino acids predicted to be involved in electron transfer pathways and measuring the effects on reaction rates with different substrates, the specific roles of residues in the electron transfer mechanism can be elucidated.

How should I design experiments to compare the Aethionema cordifolium enzyme with homologs from other species?

Designing comparative experiments to analyze Aethionema cordifolium NAD(P)H-quinone oxidoreductase alongside homologs from other species requires careful planning to ensure meaningful results. Based on successful comparative studies of NAD(P)H:quinone oxidoreductases from human, mouse, and rat species , the following experimental design is recommended:

  • Expression and purification protocol standardization: To ensure valid comparisons, all enzymes should be expressed and purified using identical protocols. If sequence differences affect purification efficiency, protocols should be optimized individually but with final protein preparations of comparable purity and stability.

  • Comparative kinetic analysis: Determine and compare kinetic parameters (Km, kcat, kcat/Km) for a standardized set of substrates including:

    • Common two-electron acceptors (e.g., 2,6-dichloroindophenol, menadione)

    • Four-electron acceptors (e.g., methyl red)

    • Both NADPH and NADH as electron donors

    Such comparative analysis revealed significant differences between rat, human, and mouse enzymes, with rat enzyme showing approximately twice the rate for menadione reduction compared to human and mouse variants .

  • Structural analysis: If crystal structures can be obtained for the different enzymes, conduct detailed comparative analysis of:

    • FAD binding site architecture

    • Substrate binding pocket configuration

    • Dimer interface characteristics

    • Flexibility of key catalytic regions

  • Sequence-structure-function correlations: Identify amino acid differences between species and correlate these with observed functional differences. For NAD(P)H:quinone oxidoreductases, a single residue difference (Tyr-104 in rat versus Gln-104 in human/mouse) explained significant kinetic differences through its effect on FAD positioning . Similar key residues could be identified in the Aethionema cordifolium enzyme.

ParameterA. cordifoliumSpecies 2Species 3Notes
Km(NADPH)To be determinedCompareCompareMeasure at standardized conditions
kcat(NADPH)To be determinedCompareCompareIndicates turnover rate
FAD bindingAnalyze interactionsCompareCompareLook for specific amino acid contacts
Substrate preferenceDetermine rank orderCompareCompareMay reflect ecological adaptations

How can I optimize expression of the recombinant protein in E. coli systems?

Optimizing the expression of recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase subunit 3 in E. coli requires systematic testing of multiple variables that affect protein yield and activity. Based on successful expression of similar oxidoreductases , the following optimization strategy is recommended:

  • Codon optimization: Analyze the native gene sequence for rare codons in E. coli and optimize accordingly. For chloroplastic proteins from plant species like Aethionema cordifolium, codon usage often differs significantly from E. coli, making optimization critical for efficient translation.

  • Expression vector selection: Test multiple vectors with different promoters (T7, tac, araBAD) and fusion tags. For NAD(P)H-quinone oxidoreductases, polyhistidine tags have been successfully used for purification without compromising activity . Consider vectors that allow tight control of expression, as overexpression may lead to inclusion body formation.

  • Expression conditions matrix:

    • Temperature: Test standard (37°C) versus lower temperatures (16-25°C) which often improve folding

    • Induction time: Compare short (3-4 hours) versus overnight induction

    • Inducer concentration: Titrate IPTG (0.1-1.0 mM) or other inducers to find optimal concentration

    • Media composition: Compare standard LB with enriched media (TB, 2YT) and defined media supplemented with additional carbon sources

  • Co-expression strategies: Consider co-expressing molecular chaperones (GroEL/ES, DnaK/J) to improve folding. For FAD-containing enzymes, co-expression of FAD synthesis or transport proteins may enhance cofactor incorporation.

  • Expression of protein fragments: If full-length expression proves challenging, consider expressing individual domains or removing the chloroplast transit peptide, which may interfere with proper folding in bacterial systems.

Monitor expression levels using SDS-PAGE and Western blotting, but importantly, always assess enzyme activity using standard NAD(P)H oxidoreductase assays to ensure that the expressed protein is functionally active.

What are the best approaches for studying substrate specificity of the enzyme?

A comprehensive investigation of substrate specificity for Aethionema cordifolium NAD(P)H-quinone oxidoreductase requires systematic testing of diverse electron acceptors and careful analysis of kinetic parameters. Based on established methodologies for similar enzymes, the following approach is recommended:

  • Substrate panel development: Assemble a diverse panel of potential substrates including:

    • Natural quinones (ubiquinone, plastoquinone, phylloquinone)

    • Synthetic quinones (menadione, duroquinone, benzoquinone derivatives)

    • Other potential electron acceptors (azo dyes, cytochrome c, ferricyanide)

  • Initial screening: Perform initial activity assays with standardized conditions (fixed substrate and enzyme concentrations) to identify compounds that serve as substrates. Use spectrophotometric methods measuring either NAD(P)H oxidation (decrease in absorbance at 340 nm) or substrate reduction (wavelength depends on substrate).

  • Detailed kinetic analysis: For substrates showing activity, determine comprehensive kinetic parameters:

    • Km and kcat for each substrate

    • Catalytic efficiency (kcat/Km)

    • Inhibition constants (Ki) if substrate inhibition occurs at higher concentrations

  • Electron donor preference: Compare activity with NADPH versus NADH across different substrates, calculating the NADPH/NADH activity ratio to determine cofactor preference. This ratio has functional significance in cellular contexts where NADPH and NADH pools have different redox potentials and metabolic roles.

  • Structure-activity relationship analysis: Correlate structural features of effective substrates with their kinetic parameters to identify key determinants of substrate recognition. For quinones, such features include ring substitution patterns, side chain properties, and redox potential.

The resulting data should be organized in a comprehensive substrate specificity profile table, as shown below:

SubstrateKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)NADPH/NADH ratioNotes
DuroquinoneTo be determinedTo be determinedTo be determinedTo be determinedStandard reference substrate
MenadioneTo be determinedTo be determinedTo be determinedTo be determinedVitamin K analog
PlastoquinoneTo be determinedTo be determinedTo be determinedTo be determinedNatural chloroplast substrate
[Other substrates]To be determinedTo be determinedTo be determinedTo be determined

How can I resolve issues with enzyme stability during purification and storage?

Maintaining stability of recombinant Aethionema cordifolium NAD(P)H-quinone oxidoreductase during purification and storage presents several challenges due to the enzyme's complex structure and cofactor requirements. Based on experience with similar oxidoreductases, the following strategies are recommended to address common stability issues:

  • Preventing FAD loss: The FAD cofactor is essential for enzyme activity but can dissociate during purification. Adding low concentrations of FAD (5-10 μM) to all purification and storage buffers can maintain cofactor saturation. Monitor FAD content spectrophotometrically by measuring the A450/A280 ratio, which indicates the degree of cofactor incorporation.

  • Buffer optimization: Systematically test different buffer conditions to identify optimal stability parameters:

    • Buffer type: Compare phosphate, HEPES, and Tris buffers at pH 7.0-8.0

    • Ionic strength: Test NaCl concentrations from 50-300 mM

    • Additives: Evaluate stabilizing agents such as glycerol (10-20%), reducing agents (1-5 mM DTT or 2-mercaptoethanol), and metal chelators (0.1-1 mM EDTA)

  • Preventing oxidative damage: NAD(P)H-quinone oxidoreductases are susceptible to oxidative inactivation. Include antioxidants such as reduced glutathione (1-5 mM) or ascorbate (0.5-2 mM) in purification buffers, and maintain an inert atmosphere (nitrogen or argon) during critical purification steps if possible.

  • Storage conditions: Compare different storage approaches:

    • Liquid storage at 4°C (short-term)

    • Frozen at -20°C or -80°C with cryoprotectants (glycerol, sucrose)

    • Lyophilization with appropriate excipients

    • Immobilization on solid supports

  • Thermal stability assessment: Determine the thermal stability profile using differential scanning fluorimetry or activity assays after incubation at different temperatures. This information can guide handling procedures during purification and long-term storage strategies.

  • Aggregation prevention: If the enzyme shows tendency to aggregate, include low concentrations of non-ionic detergents (0.01-0.05% Triton X-100) or carrier proteins (0.1% BSA) in storage buffers. Monitor aggregation using dynamic light scattering or size exclusion chromatography.

What are effective strategies for studying the role of this enzyme in chloroplast electron transport chains?

To elucidate the role of Aethionema cordifolium NAD(P)H-quinone oxidoreductase subunit 3 in chloroplast electron transport, a multi-faceted approach combining in vitro biochemical studies with in vivo physiological analyses is recommended. Based on methodologies used for studying similar chloroplastic proteins, the following strategies would be most effective:

These approaches would provide comprehensive insights into how this specific NAD(P)H-quinone oxidoreductase contributes to photosynthetic electron flow and redox regulation in chloroplasts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.