Recombinant Aethionema cordifolium NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Aethionema cordifolium (Lebanon stonecress)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFFIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGD IFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK
Uniprot No.

Target Background

Function
NDH (NAD(P)H dehydrogenase) functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be plastoquinone. It couples the redox reaction to proton translocation, conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NAD(P)H-quinone oxidoreductase in chloroplastic systems?

NAD(P)H-quinone oxidoreductases in chloroplasts play crucial roles in cellular redox control by facilitating electron transfer. These enzymes shift electrons from cytosolic NADH or NADPH to external electron acceptors such as oxygen, contributing to redox homeostasis in an otherwise oxidizing environment that could potentially damage proteins, lipids, and carbohydrates . The chloroplastic NAD(P)H-quinone oxidoreductase complex (NDH complex) specifically participates in cyclic electron flow around photosystem I, which is essential for photoprotection and optimal photosynthesis under various stress conditions.

The subunit 4L is particularly important for structural stability of the complex and likely contributes to proton translocation, though its precise mechanistic role varies across plant species. In A. cordifolium, this subunit would be expected to function similarly to other chloroplastic NAD(P)H-quinone oxidoreductases, potentially with species-specific adaptations related to its native environmental conditions.

How can I assess the cofactor preference (NADH vs. NADPH) of recombinant NAD(P)H-quinone oxidoreductase?

The cofactor preference can be systematically determined using a colorimetric assay with cell-impermeable tetrazolium salts such as WST-1. This methodology allows for real-time measurement of enzyme activity with different cofactors.

Experimental Procedure:

  • Prepare reaction mixtures containing purified recombinant enzyme in appropriate buffer

  • Add WST-1 (water-soluble tetrazolium salt) to each reaction

  • Initiate reactions by adding either NADH or NADPH at equal concentrations

  • Monitor absorbance change at 450 nm over time

  • Calculate initial velocities and compare activities with each cofactor

The ratio of activities (NADH:NADPH) can vary widely between different NAD(P)H-oxidases (0.7-5.2 has been observed in various cell types), suggesting that these enzymes may be differentially regulated or represent a family of related proteins with distinct cofactor preferences . For A. cordifolium specifically, determining this ratio would provide valuable insight into its metabolic role and evolutionary adaptations.

What are the key structural features that distinguish subunit 4L from other components of the NAD(P)H-quinone oxidoreductase complex?

The subunit 4L of NAD(P)H-quinone oxidoreductase typically exhibits several distinguishing structural features:

Structural Characteristics of Subunit 4L:

  • Low molecular weight (typically 10-15 kDa) compared to other subunits like NdhH (45-49 kDa)

  • Contains 1-2 transmembrane domains that anchor it within the thylakoid membrane

  • Features conserved residues involved in quinone binding

  • Unlike larger subunits such as NdhH that contain nucleotide-binding domains, subunit 4L primarily serves structural roles

To identify these features in A. cordifolium specifically, sequence alignment with homologous proteins from well-characterized species (such as Arabidopsis thaliana) would be recommended, followed by predictive modeling of transmembrane domains and potential interaction sites.

What expression systems are most suitable for producing recombinant chloroplastic NAD(P)H-quinone oxidoreductase subunit 4L?

Based on current research with related enzymes, several expression systems can be considered, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli- Rapid growth
- High yields
- Simple handling
- Lack of chloroplast-specific chaperones
- Potential inclusion body formation
- Use specialized vectors (pET, pBAD)
- Co-express molecular chaperones
- Lower expression temperature (16-20°C)
Yeast (P. pastoris)- Post-translational modifications
- Secretion capability
- High density cultures
- Pseudohyphae formation at certain dilution rates
- Potential repression of derepressible promoters
- Maintain D = 0.08-0.11 h^-1 in chemostat
- Monitor FLO11 expression to detect pseudohyphae
Plant-based systems- Native-like processing
- Proper folding
- Lower yields
- Longer production time
- Use strong promoters
- Co-express PDI for improved activity
- Optimize codon usage

For chloroplastic proteins specifically, including the A. cordifolium subunit 4L, the yeast system offers a good compromise between yield and proper folding, though careful monitoring for pseudohyphae formation is necessary as this can significantly reduce recombinant protein secretion and activity . If pursuing this approach, implementing chemostat cultivation with precise control of dilution rate is recommended to maximize productivity while minimizing morphological changes.

How can I troubleshoot low yields of active enzyme during recombinant expression?

Low yields of active recombinant NAD(P)H-quinone oxidoreductase can result from multiple factors. A systematic troubleshooting approach should address:

  • Expression level issues:

    • Verify transcript levels via RT-qPCR

    • Optimize codon usage for expression host

    • Test different promoter strengths and induction conditions

  • Protein folding and stability:

    • Co-express protein disulfide isomerase (PDI) to improve proper folding and activity

    • Include appropriate cofactors in growth media

    • Lower expression temperature to slow folding process

  • Secretion/extraction efficiency:

    • Monitor for pseudohyphae formation using microscopy and FLO11 expression analysis for yeast systems

    • If using yeast, maintain optimal dilution rate (D) between 0.08-0.11 h^-1 in chemostat cultivations to balance growth and protein production

    • For bacterial systems, optimize cell lysis conditions and incorporate solubilizing agents

  • Activity preservation:

    • Include stabilizing agents (glycerol, reducing agents) in purification buffers

    • Minimize freeze-thaw cycles by preparing single-use aliquots

    • Test enzymatic activity promptly after purification

The specific challenges with A. cordifolium NAD(P)H-quinone oxidoreductase subunit 4L may include its membrane-associated nature and potential requirement for other complex subunits for proper folding and stability.

What purification strategy yields the highest purity and activity for recombinant chloroplastic NAD(P)H-quinone oxidoreductase?

A multi-step purification strategy is recommended for obtaining high-purity, active enzyme:

Step-by-Step Purification Protocol:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) with a His-tag engineered at either N or C-terminus

    • Buffer composition: 50 mM phosphate buffer pH 7.4, 300 mM NaCl, 5% glycerol, 1 mM DTT

  • Intermediate Purification:

    • Ion exchange chromatography to separate based on charge properties

    • Size exclusion chromatography to remove aggregates and isolate properly folded protein

  • Activity Verification:

    • Develop a rapid colorimetric assay using WST-1 in the presence of NADH or NADPH to verify activity in collected fractions

    • Activity measurements should be performed immediately as enzyme stability may decrease over time

  • Storage Optimization:

    • Determine optimal buffer conditions through stability screening

    • Prepare single-use aliquots and store at -80°C with cryoprotectants

Throughout the purification process, it's critical to monitor both protein purity (via SDS-PAGE) and specific activity to identify steps that may compromise enzyme function. For membrane-associated proteins like subunit 4L, inclusion of mild detergents may be necessary to maintain solubility without disrupting structure and function.

How can I accurately measure NAD(P)H-quinone oxidoreductase activity in heterogeneous samples?

Measuring NAD(P)H-quinone oxidoreductase activity accurately, especially in complex biological samples, requires specific methodological considerations:

Recommended Assay Protocol:

  • Utilize cell-impermeable tetrazolium salts like WST-1 that can accept electrons directly from the enzyme without requiring intermediate electron acceptors

  • Prepare reaction mixture containing:

    • 50 mM phosphate buffer (pH 7.4)

    • 0.1-0.5 mM WST-1

    • 0.1-0.5 mM NADH or NADPH (test both separately)

    • Sample containing enzyme (standardized protein concentration)

  • Monitor absorbance change at 450 nm, which corresponds to the reduction of WST-1

  • For specific activity determination, calculate using the formula:

    Specific Activity=ΔAbsorbance/min×Reaction VolumeεWST-1×Path Length×Enzyme Quantity\text{Specific Activity} = \frac{\Delta \text{Absorbance}/\text{min} \times \text{Reaction Volume}}{\varepsilon_{\text{WST-1}} \times \text{Path Length} \times \text{Enzyme Quantity}}
  • Include appropriate controls:

    • No enzyme control (spontaneous reduction)

    • Heat-inactivated enzyme control

    • Known inhibitor control (e.g., cell-impermeable thiol-blocking agent pCMBS)

This methodology has been demonstrated to detect NAD(P)H-oxidase activity on intact cells and can be adapted for recombinant enzyme preparations . The ratio of activities with NADH versus NADPH provides valuable information about cofactor preference and can help distinguish between different enzyme variants or isoforms.

What advanced imaging techniques are most informative for studying subcellular localization of NAD(P)H-quinone oxidoreductase in plant tissues?

For studying the subcellular localization of NAD(P)H-quinone oxidoreductase in plant tissues, several advanced imaging approaches can provide complementary information:

Confocal Fluorescence Microscopy:

  • Utilize fluorescently-tagged antibodies specific to the target protein

  • For A. cordifolium NAD(P)H-quinone oxidoreductase subunit 4L, develop custom antibodies or use commercially available antibodies for homologous proteins like those available for related subunits

  • Counterstain with chloroplast markers to confirm chloroplastic localization

  • Resolution: 200-250 nm (conventional); 120-150 nm (super-resolution)

Transmission Electron Microscopy with Immunogold Labeling:

  • Offers higher resolution (0.5-2 nm) visualization of precise suborganellar localization

  • Can distinguish between thylakoid membrane, stroma, and other chloroplast compartments

  • More labor-intensive but provides definitive localization evidence

CRISPR-based Tagging with Fluorescent Proteins:

  • For in vivo studies in model organisms where genetic manipulation is possible

  • Can monitor dynamic localization changes under different environmental conditions

  • May require optimization if working with non-model organisms like A. cordifolium

When selecting an appropriate technique, consider the specific research question (static localization vs. dynamic changes), available resources, and whether working with native tissue or heterologous expression systems.

What are the most effective methods for studying protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 4L in chloroplastic complexes?

Understanding protein-protein interactions involving the NAD(P)H-quinone oxidoreductase subunit 4L requires specialized approaches suitable for membrane-associated protein complexes:

Method Comparison for Protein-Protein Interaction Studies:

MethodPrincipleAdvantagesLimitationsApplicability to 4L Subunit
Blue Native PAGESeparation of intact protein complexes- Preserves native interactions
- Relatively simple technique
- Limited resolution
- Semi-quantitative
Excellent for initial complex identification
Co-immunoprecipitationAntibody-based pull-down of protein complexes- Identifies specific interactions
- Can be performed with endogenous proteins
- Requires specific antibodies
- May disrupt weak interactions
Good for confirming stable interactions
Crosslinking Mass Spectrometry (XL-MS)Chemical crosslinking followed by MS identification- Maps interaction interfaces
- Captures transient interactions
- Complex data analysis
- Requires specialized equipment
Excellent for detailed interaction mapping
Computational PredictionStructure-based modeling- Can screen many potential interactions
- No wet-lab work required initially
- Requires validation
- Model quality dependent
Good for hypothesis generation

For the NAD(P)H-quinone oxidoreductase subunit 4L specifically, computational approaches coupling Rosetta with Protein Energy Landscape Exploration (PELE) software can accelerate the design process for interaction studies . This method can identify potential interaction partners and predict the structural basis for these interactions before experimental validation.

Experimental validation should then follow, with crosslinking mass spectrometry being particularly valuable for membrane protein complexes as it can capture interactions in their native environment.

How do mutations in conserved regions of NAD(P)H-quinone oxidoreductase subunit 4L affect enzyme kinetics and complex assembly?

Studying the effects of mutations in conserved regions requires a systematic approach combining computational prediction with experimental validation:

Recommended Workflow for Mutation Analysis:

  • Sequence Analysis and Conservation Mapping:

    • Perform multiple sequence alignment of subunit 4L across species

    • Identify highly conserved residues as primary targets for mutagenesis

    • Use integrated structure-kinetics databases such as IntEnzyDB to predict rate-perturbing mutations

  • Structure-Based Modeling:

    • Employ computational tools like Rosetta coupled with PELE to predict structural impacts

    • Identify residues likely involved in:

      • Cofactor binding

      • Subunit interactions

      • Membrane anchoring

      • Electron transfer pathways

  • Site-Directed Mutagenesis:

    • Design mutations that probe specific hypotheses about functional roles

    • Create a panel of variants with conservative and non-conservative substitutions

  • Kinetic Analysis:

    • Measure enzyme parameters (k₍cat₎, K₍M₎) for wild-type and mutant enzymes

    • Determine effects on cofactor preference (NADH vs. NADPH)

    • Quantify changes in inhibitor sensitivity

  • Complex Assembly Assessment:

    • Blue Native PAGE to visualize intact complexes

    • Size exclusion chromatography to detect shifts in complex formation

    • Thermal stability assays to measure changes in structural integrity

What computational approaches best predict allosteric regulation sites in NAD(P)H-quinone oxidoreductase complexes?

Identifying allosteric regulation sites in NAD(P)H-quinone oxidoreductase complexes benefits from advanced computational approaches:

State-of-the-Art Computational Methods:

  • Molecular Dynamics (MD) Simulations:

    • Reveal conformational changes and allosteric communication pathways

    • Implementation using GENESIS program with QM/MM capabilities provides efficient parallelization for exploring multiple enzyme variants

    • Simulation timescales: Require 100ns-1μs for adequate sampling

  • Network Analysis of Protein Structure:

    • Treats protein structure as a network of interacting residues

    • Identifies residues with high betweenness centrality as potential allosteric sites

    • Can be implemented using tools like Protein Structure Network analysis

  • Catalytic Field Analysis:

    • Identifies regions that influence catalysis at a distance

    • Computationally efficient method for screening potential allosteric sites

    • Has been successfully applied to various enzyme systems

  • Machine Learning Approaches:

    • Leverages existing structural and functional data to predict new allosteric sites

    • Requires substantial training data, which can be generated by HT-MEK

    • Most effective when combined with experimental validation

The identification of allosteric targets is particularly valuable for drug design purposes and understanding complex regulatory mechanisms . For NAD(P)H-quinone oxidoreductase specifically, allosteric regulation might be coordinated across multiple subunits of the complex, requiring analysis of the full complex rather than isolated subunits.

How can high-throughput methodologies be optimized for studying variants of NAD(P)H-quinone oxidoreductase?

High-throughput studies of enzyme variants can be significantly enhanced using recent technological advances:

HT-MEK Implementation for NAD(P)H-quinone oxidoreductase:

  • Microfluidic Platform Design:

    • Develop polymer chips with microscopic channels for precise fluid manipulation

    • Design should include:

      • Nanoliter-sized reaction chambers (1000× reduction in reagent volume)

      • Automated liquid handling integration

      • Compatible detection modalities (fluorescence, absorbance)

  • Cell-Free Protein Synthesis:

    • Utilize cell-free protein synthesis to bypass cell culture limitations

    • Procedure:

      • Prepare extract containing protein synthesis machinery

      • Deposit microscopic spots of synthetic DNA coding for enzyme variants onto slides

      • Align nanoliter chambers with protein synthesis mix over DNA spots

      • Allow protein synthesis to occur directly in reaction chambers

  • Parallel Activity Assays:

    • Integrate WST-1 colorimetric assay into microfluidic workflow

    • Automate image acquisition and data analysis

    • Enable real-time kinetic measurements across thousands of variants

  • Data Analysis Pipeline:

    • Implement machine learning algorithms to identify structure-function relationships

    • Use statistical models to predict effects of combinatorial mutations

    • Create comprehensive databases linking sequence, structure, and kinetic parameters

This approach can compress years of enzyme variant analysis into weeks , enabling comprehensive mapping of the sequence-function landscape for NAD(P)H-quinone oxidoreductase. The resulting data would be invaluable for both fundamental understanding and applications in synthetic biology or metabolic engineering.

How should researchers resolve contradictory findings about NAD(P)H-quinone oxidoreductase function across different experimental systems?

When facing contradictory findings about NAD(P)H-quinone oxidoreductase function, a structured approach to data reconciliation is essential:

Systematic Approach to Resolving Contradictions:

  • Identify Specific Contradictions:

    • Categorize contradictions by type (e.g., kinetic parameters, cofactor preference, inhibitor sensitivity)

    • Document experimental conditions associated with each finding

  • Analyze Methodology Differences:

    • Evaluate potential impact of:

      • Buffer composition and pH

      • Assay detection methods

      • Protein expression systems

      • Purification strategies

      • Presence of detergents or stabilizing agents

  • Consider Biological Context:

    • Cell-surface NAD(P)H-oxidase is distinct from trans-plasma membrane NADH-oxidoreductase

    • Different enzyme forms may respond differently to inhibitors

      • For example, capsaicin inhibits trans-plasma membrane NADH-oxidoreductase but stimulates surface NAD(P)H-oxidase

    • Metabolic status affects activity:

      • Metabolic inhibitors have minimal effect on surface NAD(P)H-oxidase but inhibit trans-membrane activity

  • Design Reconciliation Experiments:

    • Test enzyme under standardized conditions that bridge contradictory reports

    • Directly compare enzyme from different sources in parallel

    • Perform activity measurements under various cofactor concentrations and ratios

  • Apply Statistical Analysis:

    • Meta-analysis of published data when sufficient studies exist

    • Bayesian approaches to integrate prior information with new data

    • Sensitivity analysis to identify parameters with greatest impact on outcomes

The relationship between different NAD(P)H-oxidoreductase activities remains complex, with evidence suggesting they represent distinct enzymes rather than the same activity measured differently . This understanding provides a framework for interpreting seemingly contradictory findings.

What statistical approaches are most appropriate for analyzing the complex kinetic data from NAD(P)H-quinone oxidoreductase studies?

The complex kinetic behavior of NAD(P)H-quinone oxidoreductases requires sophisticated statistical approaches:

Recommended Statistical Framework:

  • Model Selection for Kinetic Data:

    • Compare multiple kinetic models (Michaelis-Menten, Hill, Ping-Pong Bi-Bi)

    • Use Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to identify most appropriate model

    • Consider:

      AIC=2k2ln(L)\text{AIC} = 2k - 2\ln(L)

      where k is the number of parameters and L is the maximum likelihood

  • Global Fitting Approaches:

    • Simultaneously fit multiple datasets with shared parameters

    • Particularly valuable for analyzing effects of inhibitors or activators

    • Implements constraints based on thermodynamic principles

  • Bayesian Parameter Estimation:

    • Incorporates prior knowledge about enzyme behavior

    • Provides complete parameter distribution rather than point estimates

    • More robust when dealing with sparse or noisy data

  • Bootstrap Resampling:

    • Generates confidence intervals for kinetic parameters

    • Does not assume normal distribution of errors

    • Procedure:

      1. Resample data points with replacement

      2. Refit model to each resampled dataset

      3. Calculate parameter distribution from multiple fits

  • Machine Learning for Complex Datasets:

    • When traditional kinetic models fail to capture complexity

    • Can integrate multiple data types (sequence, structure, activity)

    • Particularly valuable for the large datasets generated by HT-MEK

When applying these methods to NAD(P)H-quinone oxidoreductase studies, researchers should be mindful of the heterogeneity that may exist in enzyme preparations and the potential for multiple forms with different kinetic properties.

How can researchers integrate structural, functional, and evolutionary data to develop comprehensive models of NAD(P)H-quinone oxidoreductase mechanisms?

Developing comprehensive mechanistic models requires integration of diverse data types:

Integrated Analysis Framework:

  • Structural Foundation:

    • Begin with highest resolution available structures (X-ray, cryo-EM)

    • For A. cordifolium, homology modeling may be necessary based on related proteins

    • Implement QM/MM methods through GENESIS to explore reaction pathways with high efficiency

    • Generate minimum-energy pathways and free-energy profiles of enzymatic reactions

  • Functional Annotation:

    • Map activity data onto structural elements

    • Connect residue conservation with functional importance

    • Identify regions with coupled dynamics using network analysis

    • Use catalytic fields analysis to understand long-range effects on catalysis

  • Evolutionary Context:

    • Perform phylogenetic analysis across species

    • Identify co-evolving residue networks

    • Connect evolutionary patterns with functional specialization

    • Consider environmental adaptations specific to A. cordifolium's native habitat

  • Model Validation:

    • Design mutations to test model predictions

    • Compare computational predictions with experimental measurements

    • Refine model based on validation results

    • Implement iterative improvement cycle

  • Visualization and Communication:

    • Develop interactive models showing electron transfer pathways

    • Create animations of proposed catalytic mechanisms

    • Generate comprehensive databases linking sequence variants to functional properties

This integrated approach benefits significantly from new computational tools like Rosetta coupled with PELE, which can accelerate the design process . The resulting models provide testable hypotheses about enzyme function and guide further experimental investigations.

What emerging technologies will most significantly advance our understanding of NAD(P)H-quinone oxidoreductase function in the next decade?

Several emerging technologies show particular promise for advancing NAD(P)H-quinone oxidoreductase research:

Promising Technological Advances:

  • Cryo-Electron Tomography:

    • Allows visualization of enzyme complexes in their native cellular environment

    • Bridges the gap between in vitro biochemical studies and in vivo function

    • Will provide insights into chloroplastic membrane organization and complex assembly

  • Single-Molecule Enzymology:

    • Reveals heterogeneity in enzyme behavior masked in bulk measurements

    • Can detect transient conformational states and rare events

    • Particularly valuable for understanding electron transfer mechanisms

  • Cellular Metabolomics Integration:

    • Connects enzyme activity to broader metabolic networks

    • Identifies physiological substrates and products

    • Reveals regulatory mechanisms in intact systems

  • Advanced Computational Methods:

    • AlphaFold and similar AI approaches for structure prediction

    • Machine learning algorithms trained on HT-MEK data to predict functional properties

    • Quantum mechanics/molecular mechanics simulations for detailed reaction mechanisms

  • Gene Editing Technologies:

    • CRISPR-based approaches for precise modification of endogenous enzymes

    • Creation of reporter systems for activity monitoring in vivo

    • Development of conditional knockout/knockdown systems for temporal control

The integration of these technologies will enable researchers to connect molecular mechanisms with physiological functions and evolutionary adaptations. For chloroplastic NAD(P)H-quinone oxidoreductases specifically, these approaches will illuminate their roles in photosynthetic efficiency and stress responses.

How might engineered variants of NAD(P)H-quinone oxidoreductase contribute to fundamental understanding of electron transfer mechanisms?

Engineered variants offer powerful tools for dissecting electron transfer mechanisms:

Strategic Engineering Approaches:

  • Electron Transfer Pathway Manipulation:

    • Introduce mutations at key residues in proposed electron transfer pathways

    • Create variants with altered distances between redox centers

    • Measure effects on electron transfer rates and efficiency

    • Test using stopped-flow spectroscopy or electrochemical methods

  • Cofactor Specificity Engineering:

    • Design variants with altered cofactor preferences (NADH vs. NADPH)

    • Map the structural determinants of specificity

    • Develop hybrid enzymes with novel properties

    • Applications include:

      • Fundamental understanding of nicotinamide recognition

      • Creation of biosensors with desired specificity

      • Metabolic engineering applications

  • Regulatory Domain Transplantation:

    • Create chimeric enzymes with regulatory domains from related proteins

    • Introduce allosteric control mechanisms

    • Develop light-responsive or small molecule-responsive variants

    • Test using HT-MEK to rapidly screen thousands of variants

  • Intramolecular Distance Probes:

    • Introduce pairs of residues for fluorescence resonance energy transfer (FRET)

    • Monitor conformational changes during catalysis

    • Map dynamics of protein-protein interactions within the complex

    • Correlate structural dynamics with catalytic efficiency

These engineering approaches, when combined with high-throughput screening methods like HT-MEK, can compress years of conventional enzyme characterization into weeks . The resulting insights would significantly advance our understanding of fundamental electron transfer mechanisms in biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.