Recombinant Aethionema cordifolium Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aethionema cordifolium psbB

The CP47 chlorophyll apoprotein (psbB) is a core antenna protein of Photosystem II (PSII) in oxygenic phototrophs. Recombinant production of this protein from Aethionema cordifolium (a Brassicaceae species) enables functional and structural studies of PSII assembly and chlorophyll binding. The protein is expressed via heterologous systems (e.g., E. coli, insect cells) and purified for research applications .

Molecular Properties

PropertyDetailSource
Gene IDpsbB
Protein Length~508 amino acids (full-length)
Molecular Weight~55 kDa (theoretical); ~120 kDa (native complex)
Chlorophyll BindingBinds 16 chlorophyll a molecules, arranged in lumenal/stromal layers
Transmembrane Helices6 α-helices, forming a scaffold for pigment organization

The protein forms part of the PSII core complex, stabilizing chlorophyll and facilitating energy transfer to the reaction center (D1/D2) .

Role in PSII Assembly

  • Critical for PSII Core Formation: CP47 interacts with D2 and small subunits (PsbH, PsbL, PsbT) to form the CP47 module (CP47m) .

  • Chlorophyll Insertion: Requires assembly factors like Pam68 and PsbH for proper chlorophyll binding and membrane insertion .

  • Stability in Isolation: Isolated CP47 tends to refold non-natively, losing β-carotene and destabilizing chlorophyll binding sites .

Production and Expression Systems

Recombinant Aethionema cordifolium psbB is produced via heterologous expression, with host systems influencing yield and post-translational modifications:

Host SystemYield & TurnaroundPost-Translational ModificationsApplicationsSource
E. coliHigh yields, shortLimited (no chlorophyll binding)Structural studies, antigen production
Insect CellsModerate yieldsChlorophyll insertion possibleFunctional PSII reconstitution
Mammalian CellsLow yieldsNative folding, activity retainedStudies of protein-protein interactions

Key Notes:

  • E. coli is preferred for cost-effective production, while eukaryotic systems (insect/mammalian cells) better mimic native folding .

  • His-tagged versions (e.g., N-terminal His-tag) facilitate purification via affinity chromatography .

PSII Assembly Studies

  • Intermediate Isolation: Recombinant CP47m is used to study assembly stages, including interactions with D2 and PsbH .

  • Chlorophyll Dynamics: Computational models of CP47 in PSII dimers reveal site-specific excitation energies (e.g., B3 > B1 > others), critical for energy transfer .

Challenges and Limitations

ChallengeImpactMitigation StrategySource
Chlorophyll BindingE. coli lacks chlorophyll biosynthesis; requires exogenous additionUse insect/mammalian systems or in vitro reconstitution
Protein StabilityIsolated CP47 refolds non-natively, losing pigmentsCo-purify with PsbH/Pam68 or use membrane-mimetic environments

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Aethionema cordifolium (Lebanon stonecress)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENPSLSE VWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
CP47 is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the initial light-induced photochemical reactions within PSII. PSII acts as a light-driven water:plastoquinone oxidoreductase. Utilizing light energy, it extracts electrons from H₂O, generating O₂ and a proton gradient that is subsequently used for ATP synthesis.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of CP47 (PsbB) in Photosystem II?

CP47 serves as one of the core components of the Photosystem II (PSII) complex, playing a critical role in primary light-induced photochemical processes. The protein functions primarily as a chlorophyll-binding subunit that helps organize the light-harvesting apparatus of PSII. CP47 contains multiple transmembrane domains that anchor it within the thylakoid membrane, maintaining the structural integrity of the PSII complex. Research indicates that CP47 contains several histidine residues strategically positioned to coordinate chlorophyll molecules, with five pairs of histidine residues spaced by 13 or 14 amino acids located in hydrophobic regions of the protein . These histidine pairs are likely involved in chlorophyll binding, creating a scaffold for proper arrangement of photosynthetic pigments. Experimental evidence shows that interruption of the psbB gene results in complete loss of Photosystem II activity, demonstrating that an intact CP47 is absolutely required for functional PSII, although this does not necessarily confirm that CP47 houses the reaction center itself .

How conserved is the psbB gene across different plant species?

The psbB gene demonstrates significant evolutionary conservation across plant species, reflecting the fundamental importance of CP47 in photosynthesis. Sequence analysis reveals approximately 68% homology in DNA sequence between cyanobacterial (Synechocystis 6803) and spinach psbB genes, while the predicted amino acid sequences show even higher conservation at 76% homology . This increased protein conservation relative to nucleotide sequences suggests strong selective pressure maintaining protein function despite neutral changes in the coding sequence. Remarkably, hydropathy patterns between Synechocystis and spinach CP47 are almost indistinguishable, indicating highly conserved membrane folding patterns in the thylakoid membrane across diverse photosynthetic organisms . Cross-reactivity studies with anti-CP47 antibodies further demonstrate this conservation, with antibodies successfully recognizing the protein across numerous species including Arabidopsis thaliana, Vitis vinifera, Spinacia oleracea, Oryza sativa, and even the green alga Chlamydomonas reinhardtii .

What is the significance of Aethionema cordifolium in Brassicaceae phylogenetic studies?

Aethionema cordifolium plays a pivotal role in Brassicaceae phylogenetic studies as a critical outgroup species. In comprehensive phylogenetic analyses, A. cordifolium (along with A. grandiflorum) has been positioned as the basal lineage of the Brassicaceae family . This positioning makes Aethionema species essential reference points for rooting phylogenetic trees and establishing evolutionary relationships among the more derived Brassicaceae lineages. The unique evolutionary position of Aethionema has helped researchers define and confirm the three major lineages (I-III) within Brassicaceae with high support values . In large-scale chloroplast genome studies, Aethionema species provide an evolutionary anchor point for understanding the diversification and radiation of the entire family, allowing researchers to track genetic changes and selective pressures acting on genes like psbB throughout the evolutionary history of Brassicaceae .

What methodological approaches are used for isolating Photosystem II complexes containing CP47?

Isolation of intact Photosystem II complexes requires careful consideration of detergent selection and buffer conditions to maintain structural integrity. Current methodological approaches typically involve:

  • Thylakoid membrane solubilization using specific detergent combinations, often employing α-DDM (n-dodecyl-β-D-maltoside) or β-DDM with additional detergents like digitonin .

  • pH optimization during membrane solubilization, as pH values around 7.5 have been shown to affect the binding of certain PSII subunits .

  • Detergent selection consideration, as some detergents like digitonin can disrupt structural integrity by replacing lipids essential for maintaining protein complex stability .

Research shows that detergent effects on PSII can be substantial - digitonin molecules have been observed to cause: (a) loss of the PsbJ subunit, (b) instability in a CP43 loop, (c) disorder in the D1 C-terminus, and (d) destabilization of the Mn₄CaO₅ cluster . These findings emphasize the importance of careful method development when isolating PSII complexes for structural or functional studies of CP47.

How do sequence variations in the psbB gene correlate with evolutionary adaptations in different plant lineages?

Evolutionary analysis of the psbB gene across different plant lineages reveals important patterns of selection and adaptation. Research on chloroplast protein-coding sequences has identified psbB among genes that may be under positive selection in certain plant lineages . In the Brassicaceae family, comprehensive analysis of 71 chloroplast coding sequences from 95 species revealed a total of 33 genes under positive selection, potentially including psbB . The evolutionary patterns of psbB can be correlated with specific ecological adaptations:

Plant LineagepsbB CharacteristicsPotential Adaptive Significance
Aquilegia genusLower GC content in chloroplast genes correlates with higher amino acid polymorphismMay reflect adaptation to varying light environments in different habitats
BrassicaceaeConserved sequence with specific residues under positive selectionAdaptation to diverse ecological niches across the family's radiation
Cyanobacteria vs. Plants76% amino acid sequence homology with conserved structural featuresFundamental role maintained across 3+ billion years of photosynthetic evolution

Methodologically, researchers should employ multiple sequence alignment of psbB sequences followed by calculation of dN/dS ratios to identify sites under positive selection. Mapping these sites onto structural models of CP47 can provide insights into functional adaptations in different plant lineages, particularly in regions involved in light harvesting or protein-protein interactions within the PSII complex.

What structural modifications occur in recombinant CP47 compared to native protein, and how can these be minimized?

Recombinant production of CP47 presents considerable challenges due to its complex membrane integration and chlorophyll binding properties. When comparing recombinant to native CP47, researchers should consider several key structural aspects:

  • Chlorophyll integration: Native CP47 coordinates multiple chlorophyll molecules through histidine residue pairs spaced by 13-14 amino acids in hydrophobic regions . Recombinant systems often struggle to incorporate chlorophyll properly during protein synthesis.

  • Membrane integration: The hydropathy pattern of CP47 indicates multiple transmembrane domains requiring proper membrane insertion machinery . Recombinant expression systems may not replicate the native chloroplast membrane environment.

  • Post-translational modifications: Native CP47 may undergo specific modifications not replicated in heterologous expression systems.

To minimize structural differences between recombinant and native CP47, researchers should:

Methodological ApproachImplementation StrategyExpected Outcome
Chloroplast-based expression systemsTransform chloroplasts directly with psbB constructsBetter chlorophyll integration and membrane insertion
Membrane-mimetic environmentsInclude lipids and detergents during extraction/purificationStabilization of transmembrane domains
Co-expression with chaperonesExpress key PSII assembly factors alongside psbBImproved folding and reduced aggregation
Selective detergent protocolsAvoid harsh detergents like β-DDM or high digitonin concentrationsPrevent disruption of protein-lipid interactions essential for structure

High-resolution structural analysis, such as the cryo-electron microscopy approaches used for Arabidopsis PSII, can be employed to verify structural fidelity of recombinant CP47 preparations .

How can researchers effectively use anti-CP47 antibodies for studying photosynthetic complexes?

Anti-CP47 antibodies represent powerful tools for studying photosynthetic complexes, but their effective use requires consideration of specificity, cross-reactivity, and experimental conditions. Based on antibody characterization data, researchers should consider the following methodological approaches:

  • Cross-reactivity verification: Commercial anti-CP47 antibodies (such as PHY0058A and PHY3933A) demonstrate broad cross-reactivity across multiple plant species including Arabidopsis thaliana, Spinacia oleracea, Nicotiana tabacum, and even Chlamydomonas reinhardtii . Researchers should verify cross-reactivity with their specific species of interest.

  • Sample preparation considerations:

    • Antibody products are typically provided in lyophilized form

    • Researchers should avoid repeated freeze-thaw cycles

    • Immediate storage at recommended temperatures upon receipt is essential

  • Application-specific protocols:

ApplicationMethodological ConsiderationsExpected Results
Western blottingGentle extraction with non-ionic detergents to preserve epitope integrityDetection of ~47 kDa band corresponding to CP47
ImmunoprecipitationUse of antibody-coupled magnetic beads for gentle isolation of PSII complexesCo-precipitation of CP47 with associated PSII subunits
Immuno-electron microscopyGentle fixation to preserve membrane ultrastructureLocalization of CP47 within thylakoid membrane
Fluorescence immunolocalizationCareful membrane permeabilization to allow antibody accessVisualization of CP47 distribution in intact chloroplasts

The absence of expected immunological signals may indicate structural disruption of CP47, potentially due to inappropriate detergent selection during isolation, as observed with digitonin's disruptive effects on PSII structure .

What are the critical steps in designing mutations to study chlorophyll-binding sites in CP47?

Designing mutations to study chlorophyll-binding sites in CP47 requires careful consideration of the protein's structural features and conservation patterns. Based on sequence and structural analyses, researchers should focus on:

  • Histidine targeting: The five pairs of histidine residues in CP47 that are spaced by 13 or 14 amino acids and located in hydrophobic regions represent prime targets for mutagenesis, as these are likely involved in chlorophyll binding .

  • Methodological approaches for mutation design:

ApproachImplementationAnalysis Method
Conservative substitutionsReplace histidine with similar amino acids (asparagine, glutamine)Assess partial retention of chlorophyll binding
Non-conservative substitutionsReplace histidine with alanine or leucineEvaluate complete loss of specific chlorophyll molecules
Domain swappingExchange domains between CP47 from different speciesIdentify species-specific adaptations in chlorophyll binding
Hydrophobic region alterationsModify amino acids surrounding histidine pairsAssess effects on chlorophyll orientation and energy transfer
  • Functional validation: Researchers should employ absorption spectroscopy, fluorescence lifetime measurements, and oxygen evolution assays to assess the functional impact of mutations. Loss of Photosystem II activity following psbB gene interruption demonstrates the essential nature of CP47 , suggesting that severe mutations may completely abolish function.

  • Structural verification: High-resolution structural analysis using methods similar to those employed for Arabidopsis PSII can confirm the specific effects of mutations on chlorophyll binding and protein structure.

This methodological framework allows systematic exploration of structure-function relationships in CP47, particularly regarding its role in organizing chlorophyll molecules for efficient light harvesting and energy transfer within Photosystem II.

What are the key factors in optimizing recombinant expression of Aethionema cordifolium PsbB?

Optimizing recombinant expression of Aethionema cordifolium PsbB requires addressing several challenges inherent to this complex membrane protein. Researchers should consider the following methodological approaches:

  • Expression system selection: Chloroplast transformation systems offer advantages for CP47 expression due to their ability to provide appropriate folding machinery and cofactors. Cyanobacterial hosts represent viable alternatives given the 76% amino acid sequence homology observed between plant and cyanobacterial CP47 .

  • Construct design considerations:

    • Codon optimization based on expression host

    • Inclusion of appropriate transit peptides for chloroplast targeting in nuclear transformation approaches

    • Incorporation of histidine or other affinity tags positioned to avoid interference with chlorophyll binding

  • Expression conditions optimization:

ParameterOptimization ApproachRationale
Light conditionsModerate light intensity during expressionFacilitate chlorophyll biosynthesis without photooxidative damage
TemperatureLower than standard growth temperaturesSlow expression to improve folding of complex membrane protein
Induction timingInduction at mid-log phaseBalance between cell density and metabolic capacity
Media supplementationAddition of chlorophyll precursors (δ-aminolevulinic acid)Enhance availability of pigment molecules for integration
  • Verification of expression: Beyond standard Western blotting using anti-CP47 antibodies , researchers should employ absorption spectroscopy to confirm proper chlorophyll integration and circular dichroism to verify secondary structure formation.

The recombinant expression strategy should be informed by the evolutionary position of Aethionema cordifolium as a basal lineage in Brassicaceae , potentially offering insights into ancestral features of CP47 in this plant family.

How can researchers assess the impact of detergents on CP47 structure and function during isolation procedures?

Detergent selection significantly impacts CP47 structure and function during isolation, as demonstrated by recent high-resolution structural studies of Photosystem II. Researchers should implement a systematic approach to detergent assessment:

  • Structural integrity evaluation: Recent studies reveal that digitonin molecules can disrupt PSII structure by replacing lipids that maintain structural integrity, potentially affecting CP47 . This disruption can propagate through the complex, destabilizing associated subunits and cofactors.

  • Methodological approach to detergent assessment:

Assessment MethodImplementationMeasured Outcome
Absorption spectroscopyMeasure chlorophyll absorption spectra in different detergentsShifts in chlorophyll peaks indicating altered binding environment
Blue native electrophoresisCompare migration of PSII complexes in different detergentsRetention or loss of associated subunits
Fluorescence lifetime measurementsAssess energy transfer efficiency in different detergent environmentsChanges in chlorophyll excited state decay constants
Oxygen evolution assaysMeasure PSII activity following different detergent treatmentsFunctional impact of structural alterations
Cryo-electron microscopyVisualize protein structure in different detergent micellesDirect observation of structural perturbations
  • Detergent optimization strategies:

    • Use milder detergent concentrations (α-DDM preferred over β-DDM)

    • Consider detergent mixtures optimized for membrane protein stability

    • Implement rapid exchange into amphipols or nanodiscs following initial extraction

    • Maintain pH control during solubilization, as pH 7.5 has been shown to affect subunit binding

Understanding detergent effects is particularly important given the observed sensitivity of PSII subunit binding to protocol variations, with PsbP, PsbQ, and PsbR showing variable presence in preparations depending on solubilization conditions .

How should researchers interpret evolutionary analyses of the psbB gene in the context of photosynthetic adaptation?

Interpreting evolutionary analyses of the psbB gene requires integration of sequence data with structural and functional insights. Recent large-scale chloroplast genomic studies provide a framework for this interpretation:

  • Lineage-specific selection patterns: In the Brassicaceae family, comprehensive analysis identified 33 genes under positive selection across 95 species . Researchers should determine whether psbB shows lineage-specific selection patterns and correlate these with ecological factors such as light environment, temperature regimes, or water availability.

  • Correlation with structural features:

Sequence FeatureStructural ContextEvolutionary Interpretation
Conserved histidine pairsChlorophyll binding sitesFundamental to photosynthetic function across diverse lineages
Variable loop regionsSurface-exposed protein regionsPotential adaptations to different protein-protein interactions
Lineage-specific residuesSpecies-specific variationsPossible adaptations to particular ecological niches
  • GC content variation: Research in the Aquilegia genus demonstrated that chloroplast genes with lower GC content and lower GC content at the third codon position encoded proteins with higher amino acid polymorphisms . This pattern may extend to psbB and should be analyzed across diverse plant lineages.

  • Methodological approach to evolutionary interpretation:

    • Employ multiple sequence alignment of psbB sequences from diverse plant lineages

    • Calculate dN/dS ratios to identify sites under purifying or positive selection

    • Map selected sites onto structural models of CP47

    • Correlate evolutionary patterns with known functional domains and species' ecological adaptations

The evolutionary position of Aethionema cordifolium as a basal lineage in Brassicaceae makes its psbB sequence particularly valuable as a reference point for understanding evolutionary trajectories within this diverse plant family.

What criteria should be used to evaluate the quality and integrity of purified recombinant CP47 protein?

Evaluating the quality and integrity of purified recombinant CP47 requires multiple analytical approaches addressing both structural and functional aspects of this complex membrane protein:

  • Spectroscopic assessment: Native CP47 binds multiple chlorophyll molecules coordinated by histidine residues . Absorption spectroscopy should reveal characteristic chlorophyll peaks, while circular dichroism can confirm proper secondary structure formation.

  • Multi-parameter quality assessment framework:

Quality ParameterAnalytical MethodAcceptance Criteria
PuritySDS-PAGE with silver staining>95% purity with minimal degradation products
IdentityWestern blotting with anti-CP47 antibodiesSingle band at expected molecular weight (~47 kDa)
Chlorophyll contentAbsorption spectroscopy (663 nm/645 nm ratio)Chlorophyll a/b ratio consistent with native protein
Secondary structureCircular dichroism spectroscopyAlpha-helical content matching predicted transmembrane domains
Thermal stabilityDifferential scanning fluorimetryMelting temperature comparable to native protein
HomogeneitySize-exclusion chromatographyMonodisperse peak with minimal aggregation
Functional interactionCo-immunoprecipitation with other PSII subunitsBinding to expected partner proteins
  • Structural integrity verification: High-resolution structural analysis, similar to the cryo-electron microscopy approaches used for Arabidopsis PSII , represents the gold standard for confirming proper folding and assembly.

  • Detergent considerations: Given the observed sensitivity of PSII structure to detergent selection , researchers should carefully document detergent conditions during purification and storage, as these significantly impact protein quality and integrity.

By applying these comprehensive quality assessment criteria, researchers can ensure that recombinant CP47 preparations accurately represent the native protein structure and function, enabling reliable downstream applications in structural and functional studies.

What are the emerging techniques that may advance our understanding of CP47 structure and function?

Recent technological advances offer new opportunities to deepen our understanding of CP47 structure and function. Researchers should consider these emerging approaches:

  • Cryo-electron microscopy: Recent developments have enabled high-resolution structural analysis of plant Photosystem II, as demonstrated by studies on Arabidopsis PSII . This approach can reveal detailed interactions between CP47 and other PSII components at near-atomic resolution.

  • Time-resolved spectroscopy: Advanced ultrafast spectroscopic techniques can track energy transfer processes through CP47, elucidating its role in directing excitation energy toward the reaction center.

  • Single-molecule approaches: Methods like single-molecule FRET could reveal dynamic aspects of CP47 function not accessible through ensemble measurements.

  • Computational methods: Molecular dynamics simulations can model chlorophyll-protein interactions and energy transfer pathways within CP47, complementing experimental approaches.

  • Next-generation sequencing applications: Large-scale comparative genomics, as demonstrated in Brassicaceae studies , can reveal evolutionary patterns in psbB across diverse plant lineages, potentially correlating sequence variations with functional adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.