Recombinant Aethionema cordifolium Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Core Responsibilities

The D1 protein (PsbA) in PSII is central to:

  1. Electron Transfer: Acts as a scaffold for Q_A (bound to D2) and Q_B (mobile plastoquinone) .

  2. Non-Heme Iron Coordination: Binds the hexacoordinate non-heme Fe(II) between Q_A and Q_B, facilitating electron transfer .

  3. Oxygen Evolution: Interacts with the Mn₄CaO₅ cluster via tyrosine residues (e.g., Y_Z, Y_D) .

Experimental Uses

Application AreaDetails
Electron Transfer StudiesInvestigates Q_B dynamics and redox potential modulation .
Photoinhibition ResistanceAssesses D1 degradation under high light and repair mechanisms .
PSII AssemblyExamines interactions with subunits like PsbH, PsbL, and PsbT .
Structural BiologyTemplate for crystallization or cryo-EM studies .

PsbA Homologs in Other Organisms

OrganismUniProt IDKey Differences from A. cordifolium PsbA
Prorocentrum micansQ9TM72Dinoflagellate-specific sequence (343 aa vs. 344 aa) .
Aethionema grandifloraA4QJI0Partial sequence; expressed in yeast .

Research Gaps and Future Directions

While the recombinant protein provides a robust tool for PSII studies, gaps remain:

  • Species-Specific Adaptations: Limited data on how A. cordifolium’s PsbA differs functionally from model organisms like Synechocystis or Arabidopsis.

  • Far-Red Light Acclimation: Potential roles in modifying PSII to utilize lower-energy light, as seen in cyanobacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Aethionema cordifolium (Lebanon stonecress)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSSSLHFFLTAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transport chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Aethionema cordifolium Photosystem Q(B) protein and what is its role in photosynthesis?

Aethionema cordifolium Photosystem Q(B) protein, also known as PSII D1 protein (psbA gene product), is a critical component of Photosystem II (PSII). This 344-amino acid protein functions as a key element in the photosynthetic electron transport chain, participating in the conversion of light energy into chemical energy .

The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane. Its primary function involves binding to the secondary quinone acceptor (QB) and facilitating electron transfer during the initial stages of photosynthesis. The D1 protein contains the reaction center where charge separation occurs, making it essential for the water-splitting process that generates molecular oxygen .

Storage Conditions:

The recombinant protein is typically supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, the following protocol is recommended :

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 50%

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

Reconstitution Protocol:

For optimal reconstitution of the lyophilized protein :

  • Centrifuge the vial briefly to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (50% recommended)

  • Gently mix until completely dissolved

  • Avoid vigorous agitation that may cause protein denaturation

How can chlorophyll fluorescence analysis be used to study recombinant Photosystem II proteins?

Chlorophyll fluorescence analysis is a powerful technique for assessing Photosystem II functionality, including recombinant variants. This non-invasive method provides real-time data on photosynthetic efficiency and can detect subtle changes in PSII performance .

Methodology for Fluorescence Measurements:

  • Dark Adaptation: Samples containing recombinant PSII proteins (either in reconstituted liposomes or incorporated into thylakoid membranes) should be dark-adapted for 15-30 minutes to ensure all PSII reaction centers are in the "open" state.

  • Measurement Parameters: The following parameters provide crucial information :

    • Fv/Fm (maximum quantum efficiency): Measures the efficiency of open PSII reaction centers

    • qP (photochemical quenching): Indicates the proportion of open PSII reaction centers

    • NPQ (non-photochemical quenching): Reflects energy dissipation mechanisms

    • ΦPSII (quantum yield): Measures the efficiency of photochemistry at a given light intensity

  • Protocol for Recombinant Protein Analysis:

    • Incorporate recombinant proteins into liposomes or membrane systems

    • Apply saturating light pulses (>3000 μmol m-2 s-1) for 0.8-1.0 seconds

    • Measure fluorescence parameters using a fluorometer with modulated excitation

    • Compare results to wild-type controls to assess functional differences

ParameterFormulaPhysiological SignificanceTypical Range for Functional PSII
Fv/Fm(Fm-Fo)/FmMaximum quantum efficiency0.75-0.85
qP(Fm'-F)/(Fm'-Fo')Proportion of open PSII centers0.4-1.0
NPQ(Fm-Fm')/Fm'Heat dissipation capacity0.5-3.0
ΦPSII(Fm'-F)/Fm'Effective quantum yield0.2-0.8

This approach allows researchers to determine whether recombinant A. cordifolium Photosystem Q(B) protein retains functional capabilities comparable to native protein .

What experimental approaches can be used to study structure-function relationships in recombinant Photosystem Q(B) protein?

Understanding structure-function relationships in recombinant Photosystem Q(B) protein requires multiple complementary approaches:

Site-Directed Mutagenesis Studies:

Targeted mutations can be introduced into the recombinant protein to assess the role of specific amino acid residues. Key targets include:

  • Quinone-binding pocket residues

  • Transmembrane helices involved in protein-protein interactions

  • Residues coordinating cofactors (chlorophylls, pheophytins)

Biophysical Characterization:

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure integrity

  • Electron Paramagnetic Resonance (EPR): To study electron transfer events

  • Cryo-electron Microscopy: Following the approach used for photosystem structural studies

Functional Reconstitution:

Incorporate the recombinant protein into liposomes with other PSII components to measure:

  • Oxygen evolution rates

  • Electron transfer kinetics

  • Herbicide binding properties

Comparative Analysis:

Compare structural and functional properties with homologs from other species to identify conserved features versus species-specific adaptations .

How does A. cordifolium Photosystem Q(B) protein differ from homologs in other Brassicaceae species?

Comparative analysis of Photosystem Q(B) proteins across the Brassicaceae family reveals both conserved regions essential for function and variable regions that may reflect evolutionary adaptation . Studies on chloroplast evolution in Brassicaceae provide insights into these differences:

  • Sequence Conservation: The psbA gene (encoding Photosystem Q(B) protein) shows high conservation across Brassicaceae, but with species-specific variations in non-critical regions. Phylogenetic analysis places A. cordifolium in a distinct position within the family taxonomy .

  • Selection Pressure: Analysis of codon usage frequency between related species (such as Cardamine resedifolia and Cardamine impatiens) has identified signatures of positive selection in photosynthetic genes. Similar analysis for A. cordifolium Photosystem Q(B) protein would reveal evolutionary pressures specific to this species .

  • Structural Adaptations: While core functional domains remain conserved, subtle differences in protein sequence may influence:

    • Thermal stability

    • pH optimum for function

    • Resistance to photoinhibition

    • Interaction with light-harvesting complexes

  • Evolutionary Context: As a member of the Brassicaceae family, A. cordifolium represents an important evolutionary position for understanding photosystem adaptation. Its classification within the phylogenetic tree helps researchers understand the diversification of photosynthetic machinery .

What are the optimal protocols for functional assays with recombinant Photosystem Q(B) protein?

When working with recombinant A. cordifolium Photosystem Q(B) protein, several functional assays can assess its biological activity:

Electron Transport Assays:

  • Artificial Electron Acceptor Assay:

    • Reconstitute protein in liposomes with minimal PSII components

    • Use artificial electron acceptors (e.g., dichlorophenolindophenol)

    • Measure spectrophotometric changes at 600 nm

    • Calculate electron transport rates under different light intensities

  • Oxygen Evolution Measurements:

    • Incorporate protein into more complete PSII assemblies

    • Use Clark-type oxygen electrode to measure O₂ production

    • Compare activity to native PSII preparations

Binding Assays:

  • Herbicide Binding Studies:

    • The D1 protein binds various herbicides that block the QB binding site

    • Use radiolabeled herbicides or fluorescence displacement assays

    • Determine binding affinities (Kd values)

    • Compare wild-type and mutant proteins to map binding determinants

  • Protocol for Quinone Binding Analysis:

    • Purify recombinant protein using His-tag affinity chromatography

    • Reconstitute in liposomes with appropriate lipid composition

    • Perform equilibrium binding assays with various quinone derivatives

    • Analyze data using Scatchard or Hill plots

How can researchers troubleshoot common issues with recombinant Photosystem Q(B) protein expression and purification?

Expressing and purifying functional membrane proteins like Photosystem Q(B) protein presents several challenges:

Expression Troubleshooting:

IssuePotential CauseSolution
Low expression yieldProtein toxicity to E. coliUse tightly regulated expression systems; lower induction temperature to 16-18°C
Inclusion body formationImproper foldingCo-express with chaperones; use specialized E. coli strains (e.g., C41/C43)
DegradationProtease activityAdd protease inhibitors; use protease-deficient strains
Loss of chlorophyll bindingLack of chlorophyll in E. coliConsider expression in green algae or cyanobacterial systems for fully functional protein

Purification Considerations:

  • Detergent Selection: Critical for maintaining protein structure and function

    • Try mild detergents (DDM, LMNG) for initial solubilization

    • Consider detergent exchange during purification

    • Use lipid supplementation to stabilize the protein

  • Purification Strategy:

    • Two-step purification recommended: His-tag affinity followed by size exclusion

    • Monitor protein quality using SDS-PAGE and Western blotting

    • Verify secondary structure using circular dichroism

  • Quality Control:

    • Assess purity using gel-based and spectroscopic methods

    • Verify proper folding using intrinsic fluorescence

    • Confirm identity using mass spectrometry

What experimental design considerations are important when incorporating recombinant Photosystem Q(B) protein into membrane systems?

The function of Photosystem Q(B) protein depends heavily on its proper incorporation into membrane environments:

Liposome Reconstitution Protocol:

  • Lipid Composition: Use a mixture resembling thylakoid membranes

    • 40% MGDG (monogalactosyldiacylglycerol)

    • 30% DGDG (digalactosyldiacylglycerol)

    • 15% SQDG (sulfoquinovosyldiacylglycerol)

    • 15% PG (phosphatidylglycerol)

  • Reconstitution Procedure:

    • Solubilize lipids in chloroform, dry under nitrogen

    • Hydrate with buffer containing detergent

    • Add purified recombinant protein

    • Remove detergent using Bio-Beads or dialysis

    • Verify incorporation using freeze-fracture electron microscopy

  • Experimental Variables to Control:

    • Protein-to-lipid ratio (critical for function)

    • Buffer composition (pH, salt concentration)

    • Temperature during reconstitution process

    • Light exposure (minimize to prevent photodamage)

  • Functional Verification:

    • Measure lateral protein diffusion using FRAP (Fluorescence Recovery After Photobleaching)

    • Assess protein orientation using proteolytic digestion

    • Perform electron transport measurements to confirm activity

How can phylogenetic analysis of Photosystem Q(B) protein advance our understanding of photosynthetic evolution?

Photosystem Q(B) protein (D1) is highly conserved across photosynthetic organisms but shows important evolutionary adaptations. Phylogenetic analysis using A. cordifolium as a reference point provides valuable insights :

  • Evolutionary Rate Analysis:

    • The psbA gene is under strong purifying selection

    • Comparative analysis across Brassicaceae reveals sites under positive selection

    • These sites often correlate with adaptation to different light environments

  • Research Methodology:

    • Obtain psbA sequences from diverse Brassicaceae species

    • Align sequences using MUSCLE or similar algorithms

    • Construct phylogenetic trees using Maximum Likelihood methods

    • Calculate dN/dS ratios to identify selection pressures

    • Map variable sites onto structural models

  • Evolutionary Insights:

    • A. cordifolium's position within Brassicaceae phylogeny provides context for understanding photosystem evolution

    • Comparison with D1 proteins from distant taxa reveals fundamental adaptations in PSII

    • Analysis can identify convergent evolution in species from similar ecological niches

What insights can structural comparisons between different photosystems provide for understanding A. cordifolium Photosystem Q(B) protein?

Structural studies of photosystems across different species provide valuable comparative data:

  • Cross-Species Structural Comparisons:

    • Comparing A. cordifolium Photosystem Q(B) protein with homologs from model organisms

    • Identifying structural features unique to Brassicaceae versus conserved across all oxygenic phototrophs

    • Using high-resolution structures like the 2.04-Å Photosystem I structure from Gloeobacter violaceus as reference points

  • Functional Domains Analysis:

    • Quinone binding pocket architecture differences

    • Chlorophyll binding site variations

    • Protein-protein interaction interfaces

  • Evolutionary Implications of Structural Differences:

    • The absence of certain chlorophylls in primitive photosystems (as seen in Gloeobacter) provides insights into the evolution of energy transfer pathways

    • Similar analysis of A. cordifolium Photosystem Q(B) protein could reveal specific adaptations within Brassicaceae

  • Research Applications:

    • Using structural knowledge to design chimeric proteins for functional studies

    • Engineering photosystems with enhanced properties based on features from different species

    • Understanding the molecular basis for environmental adaptations in photosynthesis

How does environmental stress affect the structure and function of Photosystem Q(B) protein?

Environmental stressors significantly impact Photosystem II, with the D1 protein being particularly susceptible to damage:

  • Salt Stress Responses:

    • Studies in Arabidopsis (a Brassicaceae family member) show altered root:shoot ratios under salt stress

    • Similar investigations using A. cordifolium could reveal species-specific adaptations

    • Potential research approach: Express recombinant A. cordifolium Photosystem Q(B) protein in salt-sensitive plants to assess functional differences

  • Light Stress and Photoinhibition:

    • The D1 protein is the primary target of light-induced damage

    • Chlorophyll fluorescence analysis can quantify this damage

    • Research protocol:

      • Expose samples to high light intensities

      • Measure Fv/Fm decline over time

      • Calculate repair rates by protein synthesis inhibition

      • Compare A. cordifolium D1 with other species

  • Temperature Stress Effects:

    • Thermal stability of D1 varies across species

    • Circular dichroism and differential scanning calorimetry can measure these differences

    • Correlate thermal stability with environmental adaptations of source species

  • Experimental Design Considerations:

    • Control for acclimation versus adaptation responses

    • Use multiple stress factors to assess interaction effects

    • Compare recombinant protein with native protein where possible

    • Consider evolutionary history when interpreting results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.