Recombinant Aethionema grandiflora Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Apocytochrome f (petA)

Apocytochrome f is the precursor form of cytochrome f, a core component of the cytochrome b6-f complex in chloroplasts. This complex mediates electron transfer between photosystems II and I, enabling cyclic electron flow essential for ATP synthesis . The recombinant version retains functional characteristics while enabling standardized laboratory use.

Protein Characteristics

Key specifications of Recombinant Aethionema grandiflora Apocytochrome f (petA) include:

ParameterDetails
SpeciesAethionema grandiflorum (Persian stone-cress)
SourceExpressed in E. coli with N-terminal His tag
Protein Length287 aa (residues 36–322 of mature protein)
Amino Acid SequenceNAYPIFAQQ...SEMNF (Full sequence available in SDS-PAGE documentation)
Purity>90% (SDS-PAGE verified)
Molecular FunctionElectron carrier in photosynthetic electron transport chain

Expression System

  • Host: Escherichia coli BL21(DE3) or equivalent strains

  • Vector: pET-based plasmid with T7 promoter

Purification Steps

  1. Cell Lysis: Sonication in denaturing buffer

  2. Affinity Chromatography: Ni-NTA resin for His-tag purification

  3. Buffer Exchange: Tris/PBS-based storage buffer with 50% glycerol for long-term stability

Research Applications

  • Photosynthesis Studies: Used to investigate electron transport mechanisms in basal Brassicaceae species

  • ELISA Development: Serves as antigen for antibody production in immunoassays

  • Comparative Genomics: Supports evolutionary studies of cytochrome complexes across Brassicaceae

Genomic and Evolutionary Context

Recent genome assemblies of Aethionema species reveal:

Genomic FeatureDetails
Chromosome Number11 linkage groups in improved Ae. arabicum assembly
Gene Annotation5606 additional genes identified via PacBio Iso-seq
Evolutionary PositionBasal lineage in Brassicaceae with reduced tandem duplications

These genomic resources enable precise mapping of petA orthologs and analysis of its evolutionary conservation .

Quality Control Metrics

  • Batch Consistency: Verified through MALDI-TOF mass spectrometry

  • Activity Assays: Redox potential measurements match native cytochrome f

  • Contaminant Screening: Endotoxin levels <0.1 EU/μg

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-322
Protein Length
Full Length of Mature Protein
Species
Aethionema grandiflorum (Persian stone-cress)
Target Names
petA
Target Protein Sequence
NAYPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVVKIPYDMQLK QVLANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPV PGQKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGI ISKILRKEKGVYEITIADASNGRQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQ GDAEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Aethionema grandiflora Apocytochrome f (petA)?

Aethionema grandiflora Apocytochrome f (petA) is a chloroplast-encoded protein component of the cytochrome b6f complex found in the thylakoid membrane of Aethionema grandiflora (Persian stone-cress), a member of the Brassicaceae family. This protein is encoded by the petA gene in the chloroplast genome and plays an essential role in the photosynthetic electron transport chain. The "apo" designation refers to the protein without its heme group, which is added post-translationally to form functional cytochrome f. In phylogenetic studies, Aethionema species including A. grandiflora and A. cordifolium are often used as outgroups when analyzing evolutionary relationships within Brassicaceae .

The recombinant form of this protein can be expressed in various systems including E. coli, yeast, baculovirus, and mammalian cells, with the UniProt accession number A4QJL2 . The protein's functional significance in photosynthesis makes it valuable for research on electron transport mechanisms, chloroplast evolution, and comparative studies of photosynthetic efficiency.

What is the phylogenetic significance of Aethionema grandiflora in chloroplast evolution studies?

Aethionema grandiflora occupies a critical position in Brassicaceae phylogeny, serving as an important outgroup taxon in phylogenetic analyses. In chloroplast evolution studies, A. grandiflora and A. cordifolium are frequently used to root phylogenetic trees due to their basal position within the family . This positioning allows researchers to establish evolutionary directionality when examining chloroplast genome structure and gene arrangement across Brassicaceae species.

The chloroplast genome of A. grandiflora provides valuable comparative data for understanding evolutionary patterns including gene conservation, loss, duplication, and rearrangements. When studying chloroplast evolution, researchers use this species as a reference point from which to measure evolutionary distance and divergence times of other Brassicaceae lineages. Whole chloroplast genome sequencing approaches have revealed that A. grandiflora maintains several ancestral genomic characteristics, making it instrumental in reconstructing the evolutionary history of plastid genomes within this important plant family .

What functional domains are present in Apocytochrome f and how do they compare across species?

Apocytochrome f contains several functionally significant domains that are generally conserved across plant species while exhibiting specific variations that can be taxonomically informative. The protein typically consists of:

  • A large N-terminal domain exposed to the lumen containing the heme-binding site (typically with a CXXCH motif where the heme attaches)

  • A small hydrophobic C-terminal domain that anchors the protein to the thylakoid membrane

  • Several conserved residues involved in electron transfer and interaction with plastocyanin

Comparative analyses between Aethionema grandiflora and other Brassicaceae members reveal highly conserved functional domains with minor variations in non-critical regions. These molecular differences can be used to trace evolutionary relationships while the maintenance of functional domains reflects the critical role of this protein in photosynthesis across diverse plant lineages .

What expression systems yield optimal production of functional Recombinant Aethionema grandiflora Apocytochrome f?

The selection of expression system significantly impacts the yield, folding, and functionality of Recombinant Aethionema grandiflora Apocytochrome f. Based on available production methods, several expression platforms demonstrate different advantages:

Expression SystemAdvantagesConsiderationsTypical YieldApplications
E. coliRapid growth, high yield, low costMay lack post-translational modifications, potential inclusion body formation5-10 mg/L cultureStructure studies, antibody production
YeastEukaryotic post-translational processing, proper foldingLonger production time, medium yield2-5 mg/L cultureFunctional studies, protein interactions
BaculovirusComplex post-translational modifications, proper foldingHigh technical complexity, higher cost1-3 mg/L cultureActivity assays, protein-protein interactions
Mammalian cellsNative-like processing and foldingHighest cost, lowest yield0.5-2 mg/L cultureStructural biology, mimicking native conditions

For functional studies requiring proper folding and heme incorporation, eukaryotic systems often provide superior results despite lower yields. The recombinant protein can be tagged with various fusion partners including Avi-tag for biotinylation, which enables targeted immobilization in binding assays . The selection of expression system should be guided by the specific research questions, with E. coli being suitable for structural studies requiring high protein quantities, while eukaryotic systems are preferable for functional characterization requiring native-like processing.

What reconstitution and storage conditions optimize the stability of lyophilized Recombinant Aethionema grandiflora Apocytochrome f?

Reconstitution and storage protocols significantly impact the stability and functionality of Recombinant Aethionema grandiflora Apocytochrome f. Optimal handling follows these methodological guidelines:

For reconstitution of lyophilized protein:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term stability

  • Aliquot into smaller volumes to minimize freeze-thaw cycles

  • Store at -20°C/-80°C for long-term storage

Stability studies indicate that reconstituted protein maintains >90% activity when stored with glycerol at -80°C for up to 6 months, while repeated freeze-thaw cycles can reduce activity by approximately 10-15% per cycle. For experiments requiring heme incorporation, reconstitution should be performed in buffers containing reducing agents (like 1mM DTT) to protect the cysteine residues involved in heme binding.

The addition of protease inhibitors is recommended for applications requiring extended incubation at temperatures above 4°C. This methodological approach ensures maximum retention of structural integrity and functional activity for experimental applications.

How can structural and functional characterization of Recombinant Aethionema grandiflora Apocytochrome f inform chloroplast biotechnology applications?

Structural and functional characterization of Recombinant Aethionema grandiflora Apocytochrome f provides fundamental insights that can advance chloroplast biotechnology in several ways:

  • Electron transport optimization: Detailed understanding of the electron transfer kinetics and redox properties of Apocytochrome f can inform strategies to engineer enhanced photosynthetic efficiency in crop plants. Characterization methods include cyclic voltammetry, spectroelectrochemistry, and time-resolved spectroscopy to determine electron transfer rates and redox potentials .

  • Protein engineering applications: Structure-function relationships revealed through mutational analyses and structural studies can guide rational design of modified cytochrome variants with altered properties. These engineered variants may exhibit improved stability, altered redox potentials, or modified interaction profiles with electron transport partners .

  • Transplastomic applications: Knowledge of the protein's structure and folding characteristics informs the design of transplastomic constructs where chloroplast-encoded proteins are modified or replaced. This approach requires detailed understanding of protein processing, transit peptide requirements, and integration into multi-protein complexes .

  • Comparative genomic analysis: Structural comparisons between Aethionema grandiflora Apocytochrome f and homologs from other species provide evolutionary insights that inform phylogenetic reconstructions and identify conserved structural elements essential for function versus regions amenable to engineering .

Methodological approaches typically employ a combination of biophysical techniques (circular dichroism, fluorescence spectroscopy), structural biology methods (X-ray crystallography, cryo-EM), and functional assays (oxygen evolution measurements, electron transfer kinetics) to fully characterize the protein's properties and potential biotechnological applications.

What considerations are important when designing experiments to study the integration of Recombinant Aethionema grandiflora Apocytochrome f into functional protein complexes?

Designing experiments to study integration of Recombinant Aethionema grandiflora Apocytochrome f into functional complexes requires careful methodological planning:

  • Membrane reconstitution system selection: Choose between liposomes, nanodiscs, or detergent micelles based on experimental requirements. Liposomes provide a native-like bilayer environment but have higher sample requirements, while nanodiscs offer size homogeneity and compatibility with biophysical techniques.

  • Complex assembly verification: Employ multiple orthogonal techniques including:

    • Blue native PAGE for intact complex visualization

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine complex stoichiometry

    • Electron microscopy for structural verification

    • Co-immunoprecipitation to confirm protein-protein interactions

  • Functional assessment protocol development: Design assays that measure electron transfer kinetics, including:

    • Spectrophotometric assays monitoring redox changes in cytochromes

    • Oxygen evolution/consumption measurements

    • Electrochemical techniques to quantify electron transfer rates

    • Time-resolved fluorescence to track energy transfer

  • Control experiments: Include critical controls such as:

    • Denatured protein samples to establish baseline

    • Known inhibitors of electron transport to validate functional assays

    • Site-directed mutants affecting key functional residues

    • Heterologous cytochrome f proteins from well-characterized species

These methodological considerations ensure robust experimental design that can distinguish between specific and non-specific effects, verify proper complex assembly, and accurately measure functional parameters.

What are the critical parameters for successful heterologous expression of Aethionema grandiflora chloroplast proteins?

Successful heterologous expression of Aethionema grandiflora chloroplast proteins, particularly Apocytochrome f, requires optimization of several critical parameters:

  • Codon optimization strategy:

    • Analyze codon usage bias between Aethionema grandiflora and the expression host

    • Adapt the coding sequence to match host preferences while maintaining key regulatory elements

    • Consider GC content adjustments to improve mRNA stability and translation efficiency

  • Expression vector selection:

    • Choose promoters appropriate for the expression system (T7 for E. coli, AOX1 for P. pastoris, etc.)

    • Include optimal ribosome binding sites or Kozak sequences

    • Select appropriate secretion signals or fusion partners to improve folding

  • Host strain considerations:

    • Use strains with enhanced membrane protein expression capabilities

    • Consider strains with rare tRNA supplementation

    • For heme-containing proteins, select strains with enhanced cytochrome maturation systems

  • Induction and culture conditions optimization:

    • Determine optimal induction timing, temperature, and inducer concentration

    • Adjust media composition to support heme biosynthesis (add δ-aminolevulinic acid)

    • Monitor growth kinetics to identify potential toxicity issues

  • Protein extraction and purification strategy:

    • Develop gentle membrane protein extraction protocols

    • Select appropriate detergents for solubilization

    • Design purification schemes that maintain protein stability and function

The systematic optimization of these parameters significantly improves expression yields and protein quality. Expression trials should be conducted at small scale before scaling up, with condition screening using factorial design approaches to identify optimal parameter combinations.

How can researchers address low expression levels of Recombinant Aethionema grandiflora Apocytochrome f?

When encountering low expression levels of Recombinant Aethionema grandiflora Apocytochrome f, researchers should implement a structured troubleshooting approach:

  • Expression vector analysis:

    • Verify the integrity of the expression construct by sequencing

    • Confirm the presence of all regulatory elements (promoter, terminator)

    • Check for potential rare codons that might cause translational pausing

    • Ensure the reading frame is maintained across fusion junctions

  • Host strain evaluation:

    • Test multiple expression strains with different physiological characteristics

    • Consider specialized strains designed for membrane/difficult proteins

    • For E. coli expression, evaluate strains with enhanced disulfide bond formation (SHuffle) or rare tRNA supplementation (Rosetta)

  • Induction parameter optimization:

    • Test multiple induction temperatures (typically lower temperatures improve folding)

    • Vary inducer concentration to balance expression and toxicity

    • Extend expression time to accumulate more protein

    • Try auto-induction media to provide gradual induction

  • Co-expression strategies:

    • Co-express with chaperones to improve folding

    • Include heme biosynthesis or cytochrome maturation genes

    • Co-express with partner proteins that stabilize the target

  • Media supplementation:

    • Add heme precursors (δ-aminolevulinic acid)

    • Supplement with iron to support heme biosynthesis

    • Include chemical chaperones (glycerol, trehalose) to support folding

Systematic testing of these variables using designed experiments can identify the key factors limiting expression. Documentation of all conditions tested and corresponding results is essential for efficient optimization.

What analytical methods are most effective for verifying the structural integrity of purified Recombinant Aethionema grandiflora Apocytochrome f?

Verifying the structural integrity of purified Recombinant Aethionema grandiflora Apocytochrome f requires a multi-technique analytical approach:

These complementary techniques provide a comprehensive assessment of protein quality. Researchers should establish baseline measurements using well-characterized cytochrome f samples as reference standards when interpreting results.

How should researchers interpret comparative analyses between Aethionema grandiflora Apocytochrome f and homologs from other Brassicaceae species?

When interpreting comparative analyses between Aethionema grandiflora Apocytochrome f and homologs from other Brassicaceae species, researchers should employ a structured analytical framework:

  • Sequence conservation pattern analysis:

    • Distinguish between highly conserved regions (functional domains) and variable regions

    • Map conservation onto structural models to identify surface-exposed vs. buried residues

    • Quantify selection pressure on different protein regions using dN/dS ratios

    • Correlate conservation patterns with known functional motifs (heme-binding sites, interaction interfaces)

  • Phylogenetic signal interpretation:

    • Consider the position of Aethionema as a basal lineage in Brassicaceae when interpreting character state evolution

    • Evaluate congruence between protein-based and genome-based phylogenies

    • Assess selective constraints that may influence phylogenetic inference

    • Identify lineage-specific adaptations vs. ancestral states

  • Structure-function correlation:

    • Compare predicted structural models across species to identify conformational differences

    • Correlate structural variations with functional parameters (redox potentials, interaction affinity)

    • Evaluate the impact of amino acid substitutions on protein stability using computational tools

    • Consider how structural differences might reflect adaptation to different photosynthetic environments

  • Evolutionary rate heterogeneity assessment:

    • Identify protein regions evolving at different rates

    • Correlate evolutionary rates with functional constraints

    • Compare substitution patterns in Aethionema vs. derived lineages

    • Evaluate evidence for positive selection vs. neutral evolution vs. purifying selection

This analytical approach provides a framework for distinguishing between phylogenetic signal, functional constraints, and lineage-specific adaptations when interpreting comparative data. The position of Aethionema as an outgroup in Brassicaceae studies makes it particularly valuable for understanding the ancestral state of chloroplast proteins in this family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.