Recombinant Aethionema grandiflora Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will then prepare your order accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Aethionema grandiflorum (Persian stone-cress)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFLYFISIVFFPWWISLCCNKSLKTWITNWWNTRQCETFLNEIQEKSLLEKF IQLEELFQLDEMLKEYPETDLQKFRLEIHKETIQFIKIHNEYRIHTIFHFSTNLISFVIL SSYSFWGKEKLFILNSWVQEFLYNLSDTIKAFLILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the cemA protein and what is its function in chloroplast biology?

The chloroplast envelope membrane protein A (cemA) is an integral membrane protein encoded by the chloroplast genome that localizes to the chloroplast inner envelope. It plays a critical role in CO₂ uptake across the chloroplast membrane and is essential for proper photosynthetic function. The protein contains multiple transmembrane domains and is conserved across many photosynthetic organisms in the Brassicaceae family, including Aethionema species . Functional analysis suggests cemA contributes to inorganic carbon transport systems, with knockout mutants showing impaired photosynthetic efficiency under limited CO₂ conditions.

How does cemA in Aethionema grandiflora compare to homologous proteins in related Brassicaceae species?

Comparative genomic analyses indicate that cemA proteins are relatively conserved among Brassicaceae species, though with notable variations in specific amino acid residues that may influence function. Aethionema, as a basal lineage in the Brassicaceae family, contains cemA protein structures that provide insight into the evolutionary development of this protein across the family . Sequence alignment studies have identified conserved domains that are essential for function, while species-specific variations may reflect adaptation to different environmental conditions. Similar to other chloroplast-encoded proteins in related species like Capsella bursa-pastoris, the cemA protein shows evidence of selection pressure related to environmental adaptation .

What chloroplast transformation methods are most effective for expressing recombinant cemA in Aethionema grandiflora?

Chloroplast transformation in Brassicaceae species typically employs biolistic methods (particle bombardment) or PEG-mediated transformation of protoplasts. For Aethionema species, modified protocols based on those established for Chlamydomonas reinhardtii may be effective . Key considerations include:

  • Selection of appropriate promoters and regulatory elements from either the native chloroplast genome or related species

  • Design of flanking sequences for homologous recombination targeting

  • Use of appropriate selectable markers (commonly antibiotic resistance genes like aadA that confers spectinomycin resistance)

  • Optimization of DNA delivery parameters for the specific tissue type

Successful transformation typically requires at least 0.4-0.5 kb homologous flanking sequences for efficient recombination, as smaller sequences (below 0.25 kb) demonstrate significantly reduced recombination efficiency .

What are the optimal vector design strategies for expressing recombinant cemA in chloroplasts?

Effective chloroplast expression vectors for recombinant cemA should contain:

  • Homologous recombination targeting sequences (0.5-1.0 kb) flanking the insertion site

  • Strong chloroplast promoters (commonly the psbA or rbcL promoter)

  • Species-specific 5' and 3' UTR elements to enhance translation efficiency

  • Codon-optimized cemA coding sequence for chloroplast expression

  • C-terminal epitope tag (such as HA-tag) for protein detection and purification

  • Selectable marker cassette (e.g., aadA for spectinomycin resistance)

The vector should target non-essential regions of the chloroplast genome, similar to approaches used in Chlamydomonas where transgenes have been successfully inserted into neutral sites or replacing non-essential genes like chlL . For multigenic engineering, careful consideration of homologous sequence positioning is necessary to prevent unwanted recombination events between repetitive elements.

How can homoplasmy be effectively confirmed following chloroplast transformation with recombinant cemA?

Confirming homoplasmy (complete replacement of wild-type plastome copies with transformed copies) is essential for stable expression and accurate functional studies. Recommended verification methods include:

MethodApplicationSensitivityLimitations
PCR analysisDetection of transgene integrationMediumMay not detect low levels of heteroplasmy
Southern blottingQuantitative assessment of homoplasmyHighLabor intensive, requires specialized equipment
DNA sequencingConfirmation of sequence accuracyVery highCost considerations for whole plastome
Western blottingVerification of protein expressionMedium-highRequires specific antibodies or epitope tags
Growth on selective mediaPhenotypic confirmationLowMay not detect low-level heteroplasmy

Multiple rounds of selection on antibiotic-containing media are typically required to achieve homoplasmy, with PCR screening and restreaking of colonies to single colonies as demonstrated in Chlamydomonas chloroplast transformation protocols .

What are the key considerations for optimizing recombinant cemA expression levels in the chloroplast?

Optimization of recombinant cemA expression requires attention to several factors:

  • Promoter selection: Strong constitutive promoters (atpA, rbcL) or inducible systems

  • 5' UTR engineering: Inclusion of species-specific translation enhancement elements

  • Codon optimization: Adaptation to chloroplast codon usage patterns

  • Integration site selection: Targeting regions with appropriate transcriptional activity

  • Post-translational stability: Addition of protein stabilizing sequences or fusion partners

Quantitative Western blot analysis using epitope tags (such as HA-tag) allows for comparison of expression levels between different constructs and transformation events . Protein accumulation may vary significantly between different recombinant proteins in the same system, as observed in Chlamydomonas where some proteins accumulate to high levels (>1% total soluble protein) while others show much lower accumulation due to differences in protein turnover rates rather than expression levels .

What approaches are effective for studying cemA protein-protein interactions within the chloroplast envelope membrane?

Investigating cemA interactions with other chloroplast proteins requires specialized approaches for membrane proteins:

  • Co-immunoprecipitation with epitope-tagged cemA as bait

  • Split-GFP complementation assays for in vivo interaction studies

  • Yeast two-hybrid membrane systems adapted for chloroplast proteins

  • Chemical crosslinking followed by mass spectrometry identification

  • Förster resonance energy transfer (FRET) between fluorescently labeled proteins

These methods must be adapted to account for the hydrophobic nature of cemA and the unique environment of the chloroplast membrane. Extraction protocols using appropriate detergents are critical for maintaining protein structure and interaction capabilities during analysis.

How can CRISPR-Cas technology be adapted for targeted modification of cemA in the chloroplast genome?

Chloroplast genome editing using CRISPR-Cas systems presents unique challenges:

  • Delivery of editing components to the chloroplast through:

    • Biolistic delivery of pre-assembled Cas9-gRNA ribonucleoproteins

    • Chloroplast expression of Cas9 from the nuclear genome with chloroplast transit peptide

    • Direct transformation with vectors containing both editing and selection components

  • Design considerations:

    • Chloroplast-specific promoters for Cas9 expression

    • gRNA design targeting unique sequences within cemA

    • Appropriate homology-directed repair templates

  • Screening and validation:

    • PCR amplification and sequencing of targeted regions

    • Restriction fragment length polymorphism analysis for detecting modifications

    • Phenotypic analysis of photosynthetic parameters

While CRISPR-Cas systems have been demonstrated in Chlamydomonas chloroplasts, adaptation to Brassicaceae chloroplasts requires optimization of delivery methods and editing efficiency parameters.

What transcriptomic approaches reveal the impact of recombinant cemA expression on chloroplast gene networks?

Comprehensive transcriptomic analysis can elucidate the broader impacts of cemA modification:

  • RNA-seq analysis of chloroplast and nuclear transcriptomes to identify differentially expressed genes (DEGs) between wild-type and cemA-modified plants

  • Time-course experiments capturing dynamic responses during development

  • Comparative analysis across tissue types (seeds, roots, shoots) to detect tissue-specific effects

  • Network analysis to identify co-regulated gene clusters

As observed in Aethionema arabicum transcriptome studies, the number of DEGs can vary significantly between developmental stages and tissue types, with processes like germination showing greater transcriptional differences than later developmental stages . Analysis should focus on key pathways including:

  • Photosynthetic gene expression

  • Carbon fixation pathways

  • Stress response elements

  • Hormone signaling components

How does recombinant cemA expression affect photosynthetic efficiency in Aethionema grandiflora?

Photosynthetic performance assessment requires multiple complementary approaches:

  • Gas exchange measurements to quantify CO₂ assimilation rates

  • Chlorophyll fluorescence analysis (Fv/Fm, ETR, NPQ) to assess photosystem II efficiency

  • Carbon isotope discrimination to evaluate CO₂ concentration mechanisms

  • Growth analysis under varying CO₂ concentrations to determine functional impacts

  • Electron transport rate measurements in isolated chloroplasts

Comparative analysis between wild-type, cemA knockout, and recombinant cemA-expressing lines under different light intensities and CO₂ concentrations can reveal the specific contribution of cemA to photosynthetic function. Experiments should include both optimal and stress conditions to fully characterize the protein's role.

What molecular markers can be used to monitor chloroplast stress responses to recombinant cemA overexpression?

Monitoring chloroplast stress responses requires a multi-marker approach:

  • Transcriptomic markers:

    • Expression levels of chloroplast chaperones (cpHSP70, cpHSP60)

    • Plastid-encoded RNA polymerase-dependent gene expression

    • Retrograde signaling components

  • Biochemical markers:

    • Reactive oxygen species (ROS) levels using fluorescent probes

    • Antioxidant enzyme activities (SOD, APX, CAT)

    • Lipid peroxidation products (MDA content)

  • Structural markers:

    • Chloroplast ultrastructure via transmission electron microscopy

    • Thylakoid membrane organization

    • Chloroplast movement responses

Similar to observations in other transgenic chloroplast systems, elevated expression of stress-response genes involved in redox regulation, hormone signaling, and cell wall remodeling may indicate physiological adaptation to recombinant protein production .

How does cemA function differ between Aethionema species with different environmental adaptations?

Comparative functional analysis of cemA across Aethionema species can reveal evolutionary adaptations:

  • Sequence comparison across species with different ecological niches

  • Complementation studies in cemA mutant backgrounds

  • Recombinant expression of cemA variants from different species

  • Chimeric protein analysis to identify functionally important domains

  • Physiological characterization under controlled environmental conditions

Similar to studies in dimorphic seeds of Aethionema arabicum, which show transcriptional resetting during developmental transitions , cemA function may be differentially regulated in species adapted to different environmental conditions. Transcriptome comparisons similar to those performed for M+ seeds, M- seeds, and IND fruits in A. arabicum could reveal species-specific regulation patterns relevant to cemA function in carbon assimilation.

What strategies address protein degradation issues when expressing recombinant cemA?

Membrane protein stabilization requires specialized approaches:

  • Fusion partners and tags:

    • N-terminal transit peptides optimized for correct targeting

    • C-terminal stabilizing elements that reduce proteolytic degradation

    • Careful selection of epitope tags that minimize interference with membrane insertion

  • Expression conditions:

    • Temperature optimization during growth

    • Light regime adjustment to reduce photooxidative stress

    • Controlled induction systems if using inducible promoters

  • Extraction methods:

    • Specialized detergent combinations for membrane protein solubilization

    • Protease inhibitor cocktails optimized for chloroplast proteases

    • Rapid processing at low temperatures to minimize degradation

Protein degradation profiles should be monitored across developmental stages, as protein stability dynamics may vary significantly throughout plant development, similar to the transcriptional shifts observed during seedling establishment in Aethionema .

How can researchers overcome challenges in purifying functional recombinant cemA from chloroplast membranes?

Membrane protein purification presents unique challenges:

  • Solubilization strategies:

    • Screen multiple detergents (DDM, LDAO, Digitonin) for optimal solubilization

    • Evaluate detergent-to-protein ratios for maximum recovery

    • Consider native nanodiscs or amphipols for maintaining native environment

  • Purification approaches:

    • Affinity chromatography using epitope tags (HA-tag, His-tag)

    • Size exclusion chromatography to separate protein complexes

    • Ion exchange chromatography for final purification

  • Functional validation:

    • Reconstitution into liposomes for functional assays

    • Structural integrity assessment via circular dichroism

    • Binding partner interaction studies with purified components

Each step requires optimization and validation to ensure the purified cemA retains its native structure and function. Western blot analysis using epitope-specific antibodies can track protein recovery and purity throughout the purification process .

What bioinformatic tools are most effective for predicting cemA structural features and targeting sequences?

Computational analysis of cemA requires specialized tools for membrane proteins:

Tool/DatabaseApplicationKey FeaturesLimitations
TMHMM/HMMTOPTransmembrane domain predictionAccurate helix predictionLimited for short helices
ChloroP/TargetPTransit peptide analysisPredicts chloroplast targetingMay miss non-canonical signals
AlphaFold2Structure predictionAdvanced deep learning approachLess accurate for membrane proteins
PROTTERVisualization of topologyInteractive visual representationPrimarily visualization tool
Phylogenetic analysisEvolutionary conservationIdentifies conserved residuesRequires diverse sequences

Integrated approaches combining multiple prediction methods with experimental validation provide the most reliable structural information. Comparison with related proteins from Brassicaceae species can enhance prediction accuracy through evolutionary context .

How might synthetic biology approaches enhance cemA function for improved photosynthetic capacity?

Synthetic biology offers promising avenues for cemA enhancement:

  • Domain swapping with homologous proteins from species with efficient carbon concentration mechanisms

  • Directed evolution approaches to select for enhanced cemA variants

  • Rational design based on structure-function relationship insights

  • Integration into synthetic carbon-concentrating mechanisms

  • Co-expression with complementary transporters or regulatory elements

Success in multigenic engineering of chloroplasts, as demonstrated in Chlamydomonas with multiple recombinant proteins , suggests potential for complex pathway engineering involving cemA. Careful design of expression cassettes with appropriate regulatory elements is essential for coordinated expression of multiple components.

What research gaps remain in understanding cemA regulation under changing environmental conditions?

Key knowledge gaps include:

  • Signal transduction pathways controlling cemA expression in response to:

    • CO₂ concentration fluctuations

    • Light quality and intensity changes

    • Temperature stress

    • Water availability

  • Post-translational modifications affecting cemA:

    • Phosphorylation states under different conditions

    • Redox regulation mechanisms

    • Protein-protein interaction dynamics

  • Integration with whole-plant physiology:

    • Coordination with stomatal regulation

    • Interaction with nuclear-encoded photosynthetic components

    • Role in developmental transitions

Research approaches similar to those used in Aethionema arabicum transcriptome studies during developmental transitions could be applied to understand cemA regulation during environmental adaptation.

How can multi-omics approaches advance our understanding of recombinant cemA integration into chloroplast systems biology?

Integrated multi-omics studies offer comprehensive insights:

  • Integration of transcriptomics, proteomics, and metabolomics data to create systems-level models

  • Temporal sampling across development and stress responses

  • Spatial analysis across tissue types and subcellular compartments

  • Network analysis to identify regulatory hubs and interaction patterns

  • Comparison between different genetic backgrounds and environmental conditions

Similar to the principal component analysis approach used to distinguish transcript profiles between different seed morphs and developmental stages in Aethionema arabicum , multi-dimensional analysis of omics data can reveal complex relationships between cemA expression and broader cellular processes. This approach would build upon established techniques for chloroplast multi-gene expression while providing deeper insights into system-wide impacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.