Recombinant Aethionema grandiflora NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its inclusion.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Aethionema grandiflorum (Persian stone-cress)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSAIPFLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFVFVLILILGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic electron transport chain, and potentially the chloroplast respiratory chain. This process involves FMN and iron-sulfur (Fe-S) centers as intermediates. The primary electron acceptor in this species is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, thus conserving redox energy within a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Aethionema grandiflora NAD(P)H-quinone oxidoreductase subunit 3, and what is its role in chloroplast metabolism?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a component of the chloroplastic NAD(P)H dehydrogenase complex involved in electron transport and redox processes within the chloroplast. This protein plays an essential role in plastoquinone reduction and subsequently impacts several metabolic pathways including photosynthetic electron flow and prenylquinone metabolism . The chloroplastic NAD(P)H dehydrogenase complex functions in a manner analogous to respiratory complex I but operates within the chloroplast environment. Current research indicates that these NAD(P)H dehydrogenases are involved in redox regulation of plastoquinone pools, which serve as electron carriers in photosynthetic and respiratory electron transport chains .

How is recombinant Aethionema grandiflora NAD(P)H-quinone oxidoreductase subunit 3 typically expressed and purified for research purposes?

While the search results don't provide specific expression protocols for subunit 3, related NAD(P)H-quinone oxidoreductase subunits are commonly expressed using E. coli expression systems with affinity tags for purification . Based on established methodologies for similar proteins, the general procedure involves:

  • Gene cloning into an appropriate expression vector with a His-tag or other affinity tag

  • Expression in E. coli under optimized conditions

  • Cell lysis and extraction of the recombinant protein

  • Affinity chromatography purification

  • Final purification steps may include size exclusion chromatography

For storage and stability, the purified protein is typically stored in an appropriate buffer system, often with stabilizers such as glycerol. For example, related oxidoreductase subunits are stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and can be lyophilized for long-term storage . Reconstitution is recommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What experimental approaches are used to study the redox activity of NAD(P)H-quinone oxidoreductase subunit 3?

Researchers typically employ several complementary approaches to characterize the redox activity of NAD(P)H-quinone oxidoreductases:

When designing experiments to characterize NAD(P)H-quinone oxidoreductase activity, researchers must carefully control for non-enzymatic redox reactions, which can confound results. This typically involves proper blank corrections and controls without the enzyme or with heat-inactivated enzyme .

How does subunit 3 interact with other components of the chloroplastic NAD(P)H dehydrogenase complex?

The chloroplastic NAD(P)H dehydrogenase complex is a multi-subunit protein assembly where individual subunits work cooperatively to transfer electrons from NAD(P)H to quinones. While specific interaction data for subunit 3 is not provided in the search results, research on related NAD(P)H-quinone oxidoreductases provides insights into common interaction mechanisms.

Methodologies to study these interactions include:

  • Co-immunoprecipitation: Using antibodies against one subunit to pull down the entire complex and identify interacting partners.

  • Yeast two-hybrid or split-reporter assays: To identify direct protein-protein interactions.

  • Crosslinking studies: Using chemical crosslinkers followed by mass spectrometry to identify proteins in close proximity within the complex.

  • Blue native PAGE: To analyze intact complexes and subcomplexes under non-denaturing conditions.

Research on related NAD(P)H dehydrogenases indicates that these enzymes are often integrated within larger functional assemblies, suggesting that subunit 3 likely has important interaction interfaces with other proteins in the complex that are essential for electron transfer functions .

What approaches can be used to study the role of NAD(P)H-quinone oxidoreductase in prenylquinone metabolism?

The connection between NAD(P)H-quinone oxidoreductases and prenylquinone metabolism has been established through studies on related enzymes like NDC1. Similar methodological approaches can be applied to study subunit 3:

  • Knockout/knockdown studies: Generate plants with reduced or eliminated ndhC expression to examine effects on prenylquinone metabolism.

  • Metabolite profiling: Quantify levels of plastoquinone, plastochromanol-8, phylloquinone (vitamin K1), and tocopherol (vitamin E) in wild-type versus modified plants using HPLC or LC-MS techniques .

  • Subcellular localization studies: Determine if subunit 3 associates with plastoglobules (chloroplast lipid droplets) where prenylquinone metabolism occurs, using fluorescent protein fusions or immunogold electron microscopy .

Studies on related NAD(P)H dehydrogenases have shown that these enzymes are essential for normal accumulation of plastochromanol-8 and vitamin K1 production . This suggests that NAD(P)H-quinone oxidoreductase subunit 3 may also play a role in these biosynthetic pathways, potentially by maintaining the appropriate redox state of quinone intermediates.

How can protein engineering approaches be applied to study or enhance the function of NAD(P)H-quinone oxidoreductase subunit 3?

Protein engineering of oxidoreductases can follow a systematic three-step approach based on established maquette development principles:

  • Scaffold design: Based on natural four-α-helix bundle structures that can accommodate cofactor binding and provide an appropriate environment for electron transfer reactions .

  • Nature-inspired engineering: Incorporating key functional elements observed in natural oxidoreductases, particularly the cofactor binding sites and electron transfer pathways .

  • Iterative design process: Repeatedly characterizing and modifying the engineered protein to optimize desired activities .

For NAD(P)H-quinone oxidoreductase subunit 3 specifically, researchers could focus on:

  • Identifying key residues for cofactor binding and quinone interaction through homology modeling and sequence analysis

  • Creating site-directed mutants to test functional hypotheses

  • Designing chimeric proteins with domains from other oxidoreductases to explore functional versatility

  • Engineering enhanced stability or altered substrate specificity

This approach allows researchers to explore the fundamental engineering requirements of oxidoreductase activity in simplified protein systems, which can then inform understanding of the more complex natural systems .

What are common challenges in expressing and purifying functional recombinant NAD(P)H-quinone oxidoreductase subunit 3, and how can they be addressed?

Several challenges are commonly encountered when working with membrane-associated or chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunit 3:

  • Protein misfolding and aggregation: These proteins often require specific conditions for proper folding.

    • Solution: Optimize expression conditions (temperature, induction time, concentration of inducer), use specialized E. coli strains designed for membrane protein expression, or co-express with chaperones.

  • Low solubility: As components of membrane-associated complexes, these proteins can have hydrophobic regions that reduce solubility.

    • Solution: Use solubility enhancing fusion tags (such as SUMO, MBP, or TrxA), optimize buffer conditions, or include mild detergents during purification.

  • Loss of cofactors during purification: Many oxidoreductases require specific cofactors for activity.

    • Solution: Include cofactors in purification buffers or perform reconstitution steps after purification.

  • Protein instability: These proteins can be unstable once purified from their native environment.

    • Solution: Include stabilizers such as glycerol or trehalose in storage buffers (as seen with related proteins stored in Tris/PBS-based buffer with 6% Trehalose, pH 8.0) . Aliquot and store properly to avoid repeated freeze-thaw cycles .

How can researchers effectively assess the functional integrity of purified recombinant NAD(P)H-quinone oxidoreductase?

Assessing functional integrity requires multiple complementary approaches:

  • Activity assays: Measure NAD(P)H oxidation and quinone reduction rates spectrophotometrically.

  • Cofactor binding analysis: Assess whether the protein has retained or can bind essential cofactors through spectroscopic methods.

  • Structural integrity assessment: Use circular dichroism spectroscopy to evaluate secondary structure content and thermal stability.

  • Size exclusion chromatography: Verify that the protein exists in the expected oligomeric state rather than forming aggregates.

  • Plastoquinone analog reduction assay: Similar to studies with related enzymes, test if the purified protein can reduce plastoquinone analogs in vitro .

How might synthetic biology approaches utilizing NAD(P)H-quinone oxidoreductases contribute to understanding and engineering photosynthetic electron transfer systems?

The fundamental engineering principles derived from studying natural oxidoreductases can inform synthetic biology approaches to create novel electron transfer systems. For NAD(P)H-quinone oxidoreductases specifically:

  • Maquette-based design: Using the principles of four-α-helix bundle design to create simplified versions of NAD(P)H-quinone oxidoreductases that retain core functionality while being more amenable to engineering .

  • Modular assembly: Combining essential functional elements from different oxidoreductases to create chimeric proteins with novel activities, such as altered specificity for electron donors or acceptors .

  • Integration with artificial photosynthetic systems: Engineered NAD(P)H-quinone oxidoreductases could serve as components in artificial photosynthetic systems designed for energy production or carbon fixation.

The iterative protein design approach, which makes explicit use of experimental characterization to guide further design choices, has proven successful for introducing diverse oxidoreductase activities in engineered proteins . This approach could be applied to NAD(P)H-quinone oxidoreductase subunit 3 to explore its functional capabilities and potential applications.

What comparative genomics and evolutionary analyses could enhance our understanding of NAD(P)H-quinone oxidoreductase diversity across plant species?

Comparative studies across different plant species can provide valuable insights into the evolution and functional diversity of NAD(P)H-quinone oxidoreductases. Researchers might:

  • Compare ndhC sequences from diverse plant species to identify conserved functional domains and species-specific adaptations

  • Analyze differences in gene structure, regulatory elements, and expression patterns

  • Examine co-evolution with interacting proteins in the NAD(P)H dehydrogenase complex

  • Investigate the relationship between sequence variations and functional differences in prenylquinone metabolism across species

These comparative approaches could reveal how evolutionary pressures have shaped the structure and function of NAD(P)H-quinone oxidoreductases in different plant lineages and ecological contexts, potentially identifying adaptations related to different photosynthetic strategies or stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.