Recombinant Aethionema grandiflora NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is the structural characterization of A. grandiflora NAD(P)H-quinone oxidoreductase subunit 4L?

The NAD(P)H-quinone oxidoreductase subunit 4L from A. grandiflora is a chloroplastic protein with a computed structure model available in AlphaFold DB (AF-A4QJQ2-F1). The structure exhibits a confidence score (pLDDT global) of approximately 89.85, indicating a relatively high degree of confidence in the model . The protein consists of 101 amino acids with the sequence: MILEHVLVLSAYLFFIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGDIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK .

This sequence shows characteristic transmembrane regions common to plastid-encoded NDH complex proteins. Researchers should note that while the AlphaFold model provides a computational prediction, there are no experimental data to verify the accuracy of this specific computed structure .

How should recombinant A. grandiflora NAD(P)H-quinone oxidoreductase subunit 4L be stored and handled for optimal stability?

For optimal stability of recombinant A. grandiflora NAD(P)H-quinone oxidoreductase subunit 4L:

• Store the lyophilized powder at -20°C or -80°C upon receipt

• After reconstitution, store in a buffer containing glycerol (typically 50%) at -20°C

• For working aliquots, store at 4°C for up to one week

• Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

The recommended storage buffer is a Tris-based buffer with 50% glycerol, optimized for this specific protein . For long-term storage after reconstitution, it is advisable to make small aliquots to avoid repeated freezing and thawing. Before opening tubes, briefly centrifuge to ensure no material is lost from the cap or sides of the tube .

What expression systems are typically used for producing recombinant A. grandiflora NAD(P)H-quinone oxidoreductase proteins?

Recombinant A. grandiflora NAD(P)H-quinone oxidoreductase proteins are typically expressed using one of the following host systems:

• E. coli - Most commonly used for its simplicity and high yield

• Yeast - Used when post-translational modifications are required

• Baculovirus expression systems - For more complex protein folding requirements

• Mammalian cell lines - When authentic eukaryotic processing is critical

For the NAD(P)H-quinone oxidoreductase subunit 4L specifically, E. coli expression systems have been successfully used to produce the full-length protein (1-101 amino acids) fused to an N-terminal His tag, achieving purity greater than 90% as determined by SDS-PAGE . The choice of expression system should be guided by the specific research requirements, with E. coli being preferable for basic structural studies and mammalian cells for functional studies requiring proper folding and post-translational modifications.

What is the basic methodology for measuring NAD(P)H:quinone oxidoreductase activity in recombinant proteins?

The basic methodology for measuring NAD(P)H:quinone oxidoreductase activity involves monitoring the oxidation of NADH to NAD+ spectrophotometrically at 340 nm. The procedural steps are:

• Prepare cell lysates or purified recombinant protein in an appropriate buffer

• Establish a reaction mixture containing the enzyme sample, buffer, and menadione (or other quinone substrate)

• Add NADH (10 mM stock solution) to initiate the reaction

• Monitor the decrease in absorbance at 340 nm over 60 seconds at 10-second intervals

• Calculate enzyme activity based on the rate of NADH oxidation

For controls, include:

• A blank control containing all reagents except the enzyme

• A positive control using commercial NAD(P)H:FMN oxidoreductase (1 Unit)

It's critical to perform these measurements in the dark as NADH is light-sensitive. The reaction is based on the principle that reduced NADH absorbs at 340 nm while oxidized NAD+ does not, allowing direct quantification of enzyme activity .

How do variations in the amino acid sequence of NAD(P)H-quinone oxidoreductase subunit 4L across different plant species affect enzymatic function?

Amino acid sequence variations in NAD(P)H-quinone oxidoreductase subunit 4L across plant species result in subtle structural differences that impact enzyme kinetics and substrate specificity. Comparative analysis of sequences from A. grandiflora (MILEHVLVLSAYLFFIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGDIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK) and Saccharum officinarum (MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGDIFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNFLNN) reveals conserved regions critical for function and variable regions that may confer species-specific properties.

Research methodologies to investigate these variations include:

• Site-directed mutagenesis of conserved versus variable residues

• Enzymatic activity assays using different quinone substrates to determine substrate preference

• Structural analysis using X-ray crystallography or cryo-EM to identify conformational differences

• Molecular dynamics simulations to assess how sequence variations affect protein flexibility and active site geometry

Studies on related quinone oxidoreductases have shown that active site variations among homologs indicate differences in substrate specificities, with some enzymes preferentially catalyzing reactions with larger substrates like 9,10-phenanthrenequinone . To experimentally approach this question, researchers should perform enzyme kinetics studies with multiple quinone substrates across different plant species' enzymes to generate comparative data on Km, Vmax, and catalytic efficiency.

What methodologies can be employed to investigate the oligomeric state of A. grandiflora NAD(P)H-quinone oxidoreductase and its impact on enzyme function?

To investigate the oligomeric state of A. grandiflora NAD(P)H-quinone oxidoreductase and its functional implications, researchers can employ several complementary methodologies:

• Size Exclusion Chromatography (SEC):

  • Run purified protein through a calibrated gel filtration column

  • Compare elution volume with known molecular weight standards

  • Analyze under different buffer conditions to assess oligomeric stability

• Analytical Ultracentrifugation:

  • Perform sedimentation velocity experiments to determine the sedimentation coefficient

  • Conduct sedimentation equilibrium studies to accurately determine molecular mass

  • This approach has successfully revealed tetrameric structures in homologous proteins

• Native PAGE:

  • Run samples under non-denaturing conditions alongside known molecular weight markers

  • Compare mobility patterns to identify potential oligomeric forms

• Cross-linking Studies:

  • Treat protein with chemical cross-linkers at various concentrations

  • Analyze products by SDS-PAGE to identify oligomeric species

  • Identify intersubunit contact points by mass spectrometry

Studies on related quinone oxidoreductases have shown that enzymes like PcQOR from Phytophthora capsici function as tetramers in solution, with each asymmetric unit containing two molecules stabilized by intermolecular interactions . The tetrameric structure often contains NADPH-binding grooves and substrate-binding pockets in each subunit, which is likely critical for optimal enzymatic function.

For functional relevance assessment, compare the enzyme kinetics of different oligomeric states isolated under various conditions to determine if oligomerization impacts substrate specificity, catalytic efficiency, or cooperative behavior.

How can researchers design experiments to distinguish between NAD(P)H-quinone oxidoreductase activity and other oxidoreductase activities in complex biological samples?

Designing experiments to specifically measure NAD(P)H-quinone oxidoreductase activity in complex biological samples requires careful methodology to eliminate interference from other oxidoreductases. A comprehensive approach includes:

• Selective Inhibition Assays:

  • Use dicoumarol, a potent inhibitor of NQO1-type enzymes (Ki = 50 pM for rat enzyme)

  • Compare activity with and without inhibitor to quantify specific contribution

  • Create an inhibition profile using multiple concentrations to generate an IC50 curve

• Substrate Specificity Analysis:

  • Compare oxidation rates of NADH versus NADPH (NQO1 works with both)

  • Test multiple quinone substrates with different structural features

  • Analyze kinetic parameters (Km, Vmax) for each substrate to create a "fingerprint" of activity

• Genetic Manipulation Controls:

  • Include samples from organisms with gene deletions (e.g., CgPST2 gene-deleted strains)

  • Use RNA interference or CRISPR to create knockdown/knockout models

  • Compare wild-type and modified samples to quantify specific enzyme contribution

• Reaction Condition Optimization:

  • Vary pH, temperature, and ionic strength to find conditions that maximize target enzyme activity

  • Include appropriate cofactors (FAD) which may be required for some oxidoreductases

• Purification Strategy:

  • Apply partial purification using ion exchange or affinity chromatography

  • Assess activity in different fractions to isolate the target enzyme

A validated protocol from Battu et al. (2021) demonstrates how to measure NAD(P)H:quinone oxidoreductase activity in whole cell lysates by monitoring NADH oxidation at 340 nm in the presence of menadione, with appropriate controls to distinguish specific activity .

$\text{Activity} = \frac{\Delta \text{Absorbance}_{340\text{nm}} \times \text{Reaction Volume}}{\text{NADH extinction coefficient} \times \text{Time} \times \text{Protein amount}}$

What are the current strategies for engineering NAD(P)H-quinone oxidoreductase proteins with enhanced substrate specificity or catalytic efficiency?

Current strategies for engineering NAD(P)H-quinone oxidoreductase proteins with enhanced properties include:

• Structure-Guided Mutagenesis:

  • Target residues in the substrate-binding pocket identified from crystal structures

  • Modify the active site architecture to accommodate larger quinone substrates

  • Example: Enlarging the active site in paAzoR3 has allowed accommodation of significantly larger quinone groups

• Directed Evolution:

  • Create libraries of random mutations and screen for improved activity

  • Use iterative rounds of selection to enhance desired properties

  • Combine beneficial mutations from different rounds

• Chimeric Enzyme Construction:

  • Swap domains between related enzymes with different specificities

  • Create fusion proteins incorporating beneficial elements from multiple sources

  • Use protein domain shuffling to generate novel combinations

• Stability Engineering:

  • Introduce suppressor mutations like p.H80R and p.E247Q that have been shown to enhance stability in human NQO1

  • Modify flexible loops that affect FAD binding

  • Target regions with lower pLDDT scores in AlphaFold models for stabilization

• Cofactor Binding Optimization:

  • Enhance FAD binding affinity through mutations in the N-terminal domain

  • Modify NAD(P)H binding site for improved interaction with either NADH or NADPH

  • Introduce mutations that create additional hydrogen bonding with cofactors

Research on human NQO1 has demonstrated that certain mutations can significantly impact enzyme properties. For example, the p.P187S variant shows substantially reduced activity due to decreased FAD binding affinity (10- to 50-fold reduction) and increased structural mobility . This knowledge can be applied inversely to engineer enhanced stability and activity in plant NAD(P)H-quinone oxidoreductases through targeted modifications of equivalent residues.

The bi-modular architecture of NAD(P)H-quinone oxidoreductases, containing discrete NADPH-binding grooves and substrate-binding pockets, provides excellent opportunities for independent optimization of different functional aspects .

How does the chloroplastic localization of NAD(P)H-quinone oxidoreductase subunit 4L affect its function and interaction with other components of photosynthetic machinery?

The chloroplastic localization of NAD(P)H-quinone oxidoreductase subunit 4L critically influences its function through:

• Integration with NDH Complex:

  • Functions as part of the chloroplastic NAD(P)H dehydrogenase (NDH) complex

  • Contributes to cyclic electron flow around photosystem I

  • Participates in chlororespiration under specific environmental conditions

• Membrane Association:

  • The hydrophobic nature of subunit 4L (evident in the amino acid sequence with multiple hydrophobic residues) suggests membrane integration

  • Proper membrane insertion is essential for interaction with other NDH subunits

  • Membrane association positions the enzyme appropriately for quinone substrate access

• Oxidative Stress Response:

  • Detoxifies quinones produced during photosynthesis, particularly under high light conditions

  • Converts quinones to hydroquinones through two-electron reduction, avoiding formation of reactive semiquinones

  • Protects chloroplast components from oxidative damage

• Coordination with Other Subunits:

  • Interacts with other NDH subunits (including NdhC, NdhG, and NdhH) to form a functional complex

  • Each subunit contributes specific residues to create complete active sites

  • The assembly process is highly regulated and responds to environmental conditions

Research approaches to investigate these interactions include:

• Co-immunoprecipitation with antibodies against other NDH subunits

• Blue native PAGE to analyze intact complexes

• Fluorescence resonance energy transfer (FRET) to study protein-protein interactions in vivo

• Electron microscopy to visualize complex architecture

The localization of NAD(P)H-quinone oxidoreductase in chloroplasts provides a distinct microenvironment with specific pH, redox state, and substrate availability that differs significantly from cytosolic conditions, necessitating specialized experimental approaches for functional characterization in situ rather than relying solely on in vitro reconstitution systems.

What experimental approaches can resolve contradictory data on the catalytic mechanism of NAD(P)H-quinone oxidoreductases?

To resolve contradictory data on the catalytic mechanism of NAD(P)H-quinone oxidoreductases, researchers should implement a multi-faceted experimental approach:

• Pre-Steady-State Kinetics:

  • Use stopped-flow spectroscopy to capture transient intermediates

  • Measure rates of individual steps in the reaction mechanism

  • Determine rate-limiting steps under different conditions

  • This approach can confirm whether the enzyme follows a ping-pong mechanism as proposed

• Isotope Effect Studies:

  • Utilize deuterated NADH or NADPH to identify hydride transfer steps

  • Measure primary and secondary isotope effects to elucidate transition states

  • Compare results across different quinone substrates

• Structural Analysis with Substrate Analogs:

  • Obtain crystal structures with substrate analogs or inhibitors bound

  • Use non-hydrolyzable NAD(P)H analogs to capture pre-catalytic complexes

  • Compare structures of enzyme with different bound ligands

• Site-Directed Mutagenesis:

  • Systematically mutate residues proposed to be involved in catalysis

  • Measure effects on different kinetic parameters

  • Create a comprehensive structure-function map of the active site

• Spectroscopic Analysis:

  • Use UV-visible, fluorescence, and circular dichroism spectroscopy to monitor protein-ligand interactions

  • Employ EPR spectroscopy to detect potential radical intermediates

  • Use NMR to investigate protein dynamics during catalysis

• Computational Approaches:

  • Perform quantum mechanical/molecular mechanical (QM/MM) calculations

  • Model transition states and energy profiles for proposed mechanisms

  • Simulate enzyme dynamics during catalysis

For example, contradictory findings regarding NAD(P)H-quinone oxidoreductase activity in purified versus cellular environments (as seen with CgPst2, which showed no activity when bacterially purified but demonstrated activity in whole cell lysates) might be resolved by investigating cofactor requirements, protein oligomerization states, or post-translational modifications that might be lost during purification.

A systematic comparison of results obtained under different experimental conditions, with careful attention to protein preparation methods, buffer compositions, and assay conditions, will help identify the source of contradictory data and lead to a unified understanding of the catalytic mechanism.

What are the critical factors for optimizing the expression and purification of functional recombinant A. grandiflora NAD(P)H-quinone oxidoreductase subunit 4L?

Successful expression and purification of functional A. grandiflora NAD(P)H-quinone oxidoreductase subunit 4L requires careful optimization of several critical factors:

• Expression System Selection:

  • E. coli is commonly used but may lack post-translational modifications

  • Consider codon optimization for the host organism

  • BL21(DE3) strains are preferred for membrane proteins

  • For challenging expressions, consider Rosetta or Origami strains that provide rare tRNAs or enhanced disulfide bond formation

• Expression Conditions:

  • Optimize induction temperature (typically 16-25°C for membrane proteins)

  • Adjust IPTG concentration (0.1-1.0 mM)

  • Consider auto-induction media for gradual protein expression

  • Extend expression time (overnight to 72 hours) at lower temperatures

• Solubilization Strategy:

  • Include appropriate detergents for membrane protein extraction

  • Test multiple detergent types (DDM, LDAO, Triton X-100)

  • Add glycerol (10-25%) to stabilize the solubilized protein

  • Include cofactors (FAD) during extraction to enhance stability

• Purification Protocol:

  • Use affinity chromatography with His-tag for initial capture

  • Follow with size exclusion chromatography to remove aggregates

  • Consider ion exchange chromatography as a polishing step

  • Maintain detergent above CMC throughout purification

• Buffer Optimization:

  • Include stabilizing agents (glycerol, sucrose, trehalose)

  • Add reducing agents (DTT, β-mercaptoethanol) to prevent oxidation

  • Optimize pH based on the protein's isoelectric point

  • Consider including FAD cofactor in buffers

• Quality Control Metrics:

  • Assess purity by SDS-PAGE (aim for >90%)

  • Confirm identity by Western blot or mass spectrometry

  • Verify oligomeric state by native PAGE or SEC

  • Test enzymatic activity using the NADH oxidation assay

For chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunit 4L, the hydrophobic nature of the protein requires special attention to detergent selection and concentration. A systematic approach testing multiple expression and purification conditions in parallel will help identify optimal parameters for obtaining functionally active protein.

How can researchers accurately measure enzyme kinetics parameters for NAD(P)H-quinone oxidoreductases with multiple substrates?

Accurate measurement of enzyme kinetics parameters for NAD(P)H-quinone oxidoreductases with multiple substrates requires careful experimental design and data analysis:

• Initial Rate Determination:

  • Use sufficiently low enzyme concentration to ensure linear initial rates

  • Monitor NADH oxidation at 340 nm over short time periods (60 seconds) to capture initial velocity

  • Ensure substrate depletion is less than 10% during measurement

  • Use a spectrophotometer capable of measuring at 10-second intervals for precise rate determination

• Multi-Substrate Kinetics Approach:

  • For ping-pong bi-bi mechanisms (as observed in NQO1) :

    • Vary concentration of one substrate while keeping the other fixed

    • Repeat with different fixed concentrations of the second substrate

    • Construct double-reciprocal plots (Lineweaver-Burk) for each condition

    • Analyze patterns of parallel lines characteristic of ping-pong mechanisms

• Data Analysis Methods:

  • Fit initial velocity data to appropriate equations:

    • For ping-pong mechanism: v = (Vmax × [A] × [B]) / (Km(A) × [B] + Km(B) × [A] + [A] × [B])

    • Use non-linear regression rather than linear transformations for more accurate parameter estimation

  • Compare goodness-of-fit for different kinetic models to determine the best mechanism

• Control Experiments:

  • Include enzyme-free controls to account for non-enzymatic NADH oxidation

  • Use positive controls with commercial NAD(P)H:FMN oxidoreductase

  • Perform reactions in the dark to prevent photochemical NADH degradation

• Addressing Inhibition Effects:

  • Test for substrate inhibition at high concentrations

  • Evaluate product inhibition by adding products at varying concentrations

  • Investigate dead-end inhibitor effects to confirm the reaction mechanism

• Advanced Techniques for Complex Kinetics:

  • For enzymes showing negative cooperativity (as observed in some quinone oxidoreductases) :

    • Use the Hill equation to quantify degree of cooperativity

    • Employ stopped-flow techniques to capture transient kinetic phases

    • Consider isothermal titration calorimetry (ITC) to directly measure binding events

A comprehensive approach incorporating these methodologies will provide accurate kinetic parameters that account for the complexity of multi-substrate reactions and potential allosteric effects in NAD(P)H-quinone oxidoreductases.

What methods can be used to study the interaction between NAD(P)H-quinone oxidoreductase and different quinone substrates at the molecular level?

To investigate molecular interactions between NAD(P)H-quinone oxidoreductase and quinone substrates, researchers can employ several complementary methods:

• X-ray Crystallography:

  • Crystallize the enzyme with bound quinone substrates

  • Solve structures at high resolution (< 2.5 Å)

  • Compare binding modes of different quinones

  • Example: The crystal structure of PcQOR complexed with NADPH at 2.4 Å resolution revealed a bi-modular architecture with NADPH-binding groove and substrate-binding pocket

• Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Use chemical shift perturbation to map binding interfaces

  • Employ saturation transfer difference NMR to identify substrate binding epitopes

  • Investigate protein dynamics during substrate binding

  • NMR studies have successfully revealed increased mobility and proneness to unfolding in NQO1 variants

• Molecular Docking and Simulations:

  • Perform in silico docking of various quinones to the enzyme structure

  • Calculate binding energies and identify key interaction residues

  • Run molecular dynamics simulations to analyze binding stability

  • Generate binding pose hypotheses for experimental validation

• Site-Directed Mutagenesis:

  • Systematically mutate residues predicted to interact with quinones

  • Measure effects on kinetic parameters for different substrates

  • Create a functional map of substrate-binding residues

  • This approach has revealed that the enlarged active site in paAzoR3 accommodates larger quinone groups

• Isothermal Titration Calorimetry (ITC):

  • Directly measure thermodynamic parameters of binding (ΔH, ΔS, Kd)

  • Compare binding affinity across different quinone substrates

  • Investigate role of cofactor in substrate binding

  • ITC has been used to determine binding constants for inhibitors like dicoumarol (Kd = 120 nM for human NQO1)

• Fluorescence-Based Techniques:

  • Monitor changes in protein tryptophan fluorescence upon substrate binding

  • Use fluorescent substrate analogs to directly observe binding events

  • Employ fluorescence anisotropy to measure binding kinetics

  • Detect conformational changes through FRET with strategically placed fluorophores

• HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry):

  • Map regions with altered solvent accessibility upon substrate binding

  • Identify conformational changes induced by different quinones

  • Compare dynamics of free and substrate-bound enzyme

These methods provide complementary information about binding modes, affinity, specificity, and induced conformational changes, offering a comprehensive view of enzyme-substrate interactions at the molecular level.

How might advances in structural biology techniques enhance our understanding of NAD(P)H-quinone oxidoreductase structure-function relationships?

Emerging structural biology techniques offer significant potential for advancing our understanding of NAD(P)H-quinone oxidoreductase structure-function relationships:

• Cryo-Electron Microscopy (Cryo-EM):

  • Enables visualization of larger complexes without crystallization

  • Captures multiple conformational states simultaneously

  • Resolves structures of membrane-embedded enzyme complexes

  • Could reveal how subunit 4L interacts with other components in the chloroplastic NDH complex

• Serial Femtosecond Crystallography:

  • Uses X-ray free-electron lasers for "diffraction before destruction"

  • Captures enzymatic reactions in real-time

  • Could track structural changes during catalysis

  • May reveal transient intermediates in the quinone reduction mechanism

• Integrative Structural Biology:

  • Combines multiple techniques (X-ray, NMR, cryo-EM, SAXS)

  • Creates comprehensive models of enzyme complexes

  • Bridges gaps between atomic-level details and macromolecular assemblies

  • Would be valuable for understanding how subunit 4L functions within the larger NDH complex

• Time-Resolved Spectroscopy with Structural Methods:

  • Correlates spectroscopic changes with structural alterations

  • Monitors electron transfer events during catalysis

  • Could identify rate-limiting conformational changes

  • Would help resolve the precise mechanism of quinone reduction

• AlphaFold and AI-Based Structure Prediction:

  • Current AlphaFold models show confidence scores (pLDDT) of ~89.85 for these proteins

  • Future improvements could better predict protein-protein interfaces

  • May help model interactions with quinone substrates

  • Could assist in designing mutations for functional studies

• In-Cell Structural Biology:

  • Determines structures in native cellular environments

  • Accounts for effects of macromolecular crowding and native interactions

  • Could reveal how chloroplastic localization affects enzyme structure

  • May identify previously unknown binding partners

• Single-Molecule Techniques:

  • Observes individual molecules rather than ensemble averages

  • Detects rare conformational states or catalytic events

  • Could reveal heterogeneity in enzyme behavior

  • May identify cooperative interactions between subunits

These advanced techniques would help address key questions about NAD(P)H-quinone oxidoreductase function, including how protein dynamics influence catalysis, how subunits assemble into functional complexes, and how substrate specificity is determined at the atomic level. The integration of these approaches with existing biochemical and kinetic data would provide a more complete picture of these important enzymes.

What potential biotechnological applications might emerge from detailed understanding of plant NAD(P)H-quinone oxidoreductases?

Detailed understanding of plant NAD(P)H-quinone oxidoreductases could enable several promising biotechnological applications:

• Bioremediation of Quinone-Containing Pollutants:

  • Engineer enhanced enzymes for detoxification of environmental quinones

  • Develop immobilized enzyme systems for treatment of contaminated soils and waters

  • Create biosensors to detect quinone pollutants

  • Research methodology: Screen enzymes from different plant species for activity against environmental quinones, then optimize through directed evolution

• Stress-Resistant Crop Development:

  • Enhance oxidative stress tolerance through modulation of NAD(P)H-quinone oxidoreductase activity

  • Engineer crops with improved performance under high light or drought conditions

  • Create variants with optimized quinone detoxification efficiency

  • Experimental approach: Use CRISPR-Cas9 to modify endogenous enzymes or introduce engineered variants

• Biocatalysis for Pharmaceutical Production:

  • Utilize the stereoselective reduction capabilities for synthesis of chiral compounds

  • Develop enzyme variants with specificity for non-natural substrates

  • Create enzyme cascades incorporating NAD(P)H-quinone oxidoreductases

  • Methodological strategy: Screen enzyme libraries against pharmaceutical precursors and optimize reaction conditions

• Synthetic Biology Applications:

  • Incorporate into synthetic electron transport chains

  • Design artificial metabolic pathways for novel product synthesis

  • Create synthetic organelles with specialized detoxification functions

  • Research approach: Build modular components incorporating the enzyme within defined synthetic circuits

• Bioelectrochemical Systems:

  • Develop enzyme electrodes for biofuel cells

  • Create biosensors for quinone detection

  • Engineer interfaces between biological and electronic systems

  • Experimental methodology: Immobilize enzymes on electrode surfaces and optimize electron transfer

• Protein Engineering Platforms:

  • Use as model systems to study protein stability and dynamics

  • Develop general principles for engineering membrane-associated proteins

  • Create chimeric enzymes with novel functionalities

  • Research strategy: Apply insights from NAD(P)H-quinone oxidoreductase structure-function relationships to other enzyme families

• Photosynthesis Enhancement:

  • Optimize cyclic electron flow around photosystem I

  • Improve energy conversion efficiency in plants

  • Enhance carbon fixation through optimized NADPH regeneration

  • Experimental approach: Modulate NDH complex activity through targeted modification of key subunits