Recombinant Aethionema grandiflora Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aethionema grandiflora psbB

The Aethionema grandiflora Photosystem II (PSII) CP47 chlorophyll apoprotein (psbB) is a core component of the photosynthetic machinery in plants. As a key antenna protein, it binds chlorophyll and stabilizes the PSII complex, enabling light harvesting and energy transfer to the reaction center. The recombinant form of psbB is engineered for research purposes, offering insights into PSII assembly, photoprotection, and evolutionary dynamics .

2.2. Role in PSII Assembly and Stability

  • Core Antenna Function: psbB binds chlorophyll and transfers excitation energy to the PSII reaction center (D1/D2 proteins) .

  • Stability: Interacts with CP43 and low-molecular-weight subunits to maintain PSII integrity under photodamage .

3.1. Recombinant Production

  • Host Systems: Typically expressed in bacterial (e.g., E. coli) or yeast systems using heterologous expression vectors.

  • Purification: Affinity chromatography followed by size-exclusion chromatography to ensure >95% purity .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

ParameterValueSource
Molecular Weight~55 kDa
Chlorophyll Binding~15–20 molecules per psbB
Optimal pH7.5–8.0

3.2. Functional Assays

  • ELISA Validation: Used to detect psbB in plant extracts or recombinant preparations .

  • Protein-Protein Interactions: Co-immunoprecipitation studies confirm binding to CP43 and D1/D2 subunits .

4.1. Studies on PSII Assembly and Dynamics

  • Assembly Intermediates: psbB is critical for forming the RC47 complex, a precursor to mature PSII. Mutants lacking psbB accumulate defective RC47 complexes, impairing oxygen evolution .

  • Photoprotection: In Chlamydomonas, CP47 homologs regulate nonphotochemical quenching (NPQ) to prevent photodamage .

4.2. Comparative Genomics and Evolution

  • Orthologs: psbB is conserved across Brassicaceae (e.g., A. thaliana, Aethionema arabicum) but shows lineage-specific variations in tandem duplications and homeolog retention .

  • Positive Selection: rbcL and psbB have been identified as targets of positive selection in high-altitude Brassicaceae, suggesting adaptive evolution .

SpeciespsbB LengthKey DivergenceSource
Aethionema grandiflora508 aaChlorophyll-binding motifs intact
Amborella trichopoda508 aaConserved transmembrane domains
A. thaliana508 aaReduced tandem duplications

Challenges and Future Directions

  • Structural Elucidation: Cryo-EM studies of recombinant psbB with CP43 and D1/D2 subunits are needed to resolve assembly mechanisms .

  • Evolutionary Studies: Investigating psbB variability in Aethionema species could inform strategies for improving photoprotection in crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Aethionema grandiflorum (Persian stone-cress)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYEWDQGYFQQEIYRRVSAGLAENQSLSE VWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRAYVPFRRAESKYSVEQVGVTVELYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function
CP47 is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying psbB gene in Aethionema grandiflora compared to other Brassicaceae species?

Studying the psbB gene in Aethionema grandiflora holds particular importance because Aethionema species serve as crucial outgroups for phylogenetic analysis within Brassicaceae. Aethionema grandiflorum, along with Aethionema cordifolium, represents an early-diverging lineage that provides essential evolutionary context for understanding chloroplast evolution across the family . The psbB gene, which encodes the CP47 protein of Photosystem II, is highly conserved but exhibits subtle variations that can inform both evolutionary relationships and functional adaptations. Investigating this gene in Aethionema species provides baseline data for comparative genomics within Brassicaceae and helps elucidate how photosynthetic machinery has evolved across different lineages.

How does the structure and function of CP47 contribute to Photosystem II activity?

The CP47 protein serves as a critical internal antenna component within Photosystem II, playing an essential role in light harvesting and energy transfer to the reaction center. Structurally, CP47 contains multiple transmembrane domains with a distinctive folding pattern that is highly conserved across photosynthetic organisms . The protein contains strategically positioned histidine residues that are spaced by 13-14 amino acids in hydrophobic regions, which likely serve as chlorophyll binding sites . These histidines coordinate magnesium atoms within chlorophyll molecules, positioning them optimally for light absorption and energy transfer. Functionally, CP47 captures light energy via its bound chlorophyll molecules and transfers this excitation energy to the reaction center, where charge separation occurs. Research has demonstrated that disruption of the psbB gene results in complete loss of Photosystem II activity, confirming that CP47 is absolutely essential for functional photosynthesis .

What methods are most effective for isolating and sequencing the psbB gene from Aethionema grandiflora?

For effective isolation and sequencing of the psbB gene from Aethionema grandiflora, a combined approach using both chloroplast DNA enrichment and targeted amplification is recommended. Begin with extraction of high-quality total DNA using a CTAB-based method modified for plants with high secondary metabolite content, common in Brassicaceae species. Chloroplast DNA can be enriched through differential centrifugation or using commercial kits designed for organellar DNA isolation.

The following methodology has proven effective:

  • Design primers targeting conserved regions flanking the psbB gene based on aligned sequences from related Brassicaceae species, particularly focusing on regions that show high conservation.

  • Amplify the target region using high-fidelity polymerase with optimization for GC-rich templates (the psbB gene and surrounding regions often have higher GC content).

  • Clone amplified products into appropriate vectors for sequencing or perform direct sequencing if amplification yields are sufficient.

  • Alternatively, next-generation sequencing approaches can be employed to sequence the entire chloroplast genome, from which the psbB gene and its regulatory regions can be assembled and annotated .

Based on studies of related species, expect the Aethionema grandiflora psbB gene to be approximately 1.5 kb in length, encoding a protein of roughly 500 amino acids.

What are the expected sequence homologies between Aethionema grandiflora psbB and other well-characterized plant species?

Based on comparative analyses of psbB genes across plant species, the Aethionema grandiflora psbB sequence is expected to show significant homology with other members of Brassicaceae and more distant photosynthetic organisms. When comparing across evolutionary distances, the following homology patterns can be anticipated:

Species ComparisonDNA Sequence HomologyProtein Sequence Homology
Within Brassicaceae85-95%90-98%
Other eudicots75-85%85-90%
Monocots70-80%80-88%
Cyanobacteria (e.g., Synechocystis)65-70%75-80%

For context, the psbB gene from Synechocystis 6803 shows 68% DNA sequence homology and 76% protein sequence homology with that of spinach , suggesting that despite significant evolutionary distance, the core functional domains of CP47 remain well conserved. In Aethionema grandiflora, we would expect especially high conservation of the histidine residues involved in chlorophyll binding, which are typically arranged in pairs spaced by 13-14 amino acids within the hydrophobic domains of the protein . The hydropathy patterns would likely be almost indistinguishable from other Brassicaceae species, indicating evolutionary pressure to maintain the specific membrane folding pattern essential for proper function.

How can researchers identify and characterize regulatory elements in the psbB gene promoter region?

To identify and characterize regulatory elements in the psbB promoter region of Aethionema grandiflora, researchers should employ a systematic approach combining in silico analysis with experimental validation:

  • Sequence-based analysis:

    • Perform phylogenetic footprinting by aligning the intergenic regions upstream of psbB from multiple Brassicaceae species to identify conserved non-coding sequences

    • Use specialized plant promoter prediction tools to identify −10 and −35 consensus sequences, transcription start sites, and potential regulatory motifs

    • Search for known chloroplast promoter elements, particularly those recognized by plastid-encoded RNA polymerase (PEP) and nuclear-encoded RNA polymerase (NEP)

  • Experimental validation:

    • Conduct 5' RACE experiments to precisely map transcription start sites

    • Perform electrophoretic mobility shift assays (EMSAs) to identify protein-DNA interactions at potential regulatory regions

    • Create a series of reporter gene constructs with progressive deletions of the promoter region to identify critical regulatory segments

Key features to investigate include sigma factor binding sites, which are critical for plastid gene expression and known to differ between species. Some plastomes may show regulatory differences in intergenic regions like the clpP-psbB spacer, which has been associated with altered psbB expression levels in certain species . These differences can be functionally significant – for example, a specific deletion in the clpP-psbB intergenic region in plastome I was linked to down-regulation of psbB transcripts and reduced CP47 protein levels, affecting Photosystem II efficiency .

What post-translational modifications affect CP47 function, and how can they be detected?

CP47 undergoes several post-translational modifications (PTMs) that critically influence its folding, stability, and functional integration into Photosystem II. These modifications include:

  • N-terminal processing: The initial translation product contains a transit peptide that is cleaved during chloroplast import and subsequent thylakoid membrane integration.

  • Phosphorylation: Several threonine and serine residues can be phosphorylated, particularly under high light conditions, as part of the PSII repair cycle.

  • Oxidative modifications: Specific residues may undergo oxidative modifications during photoinhibition and repair cycles.

To detect and characterize these modifications, the following methodological approaches are recommended:

  • Mass spectrometry-based approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) after tryptic digestion of isolated CP47

    • Phosphoproteomic analysis using titanium dioxide (TiO₂) enrichment for phosphorylated peptides

    • Electron transfer dissociation (ETD) fragmentation for improved PTM site localization

  • Immunological methods:

    • Western blotting using modification-specific antibodies (e.g., anti-phosphothreonine)

    • Immunoprecipitation followed by mass spectrometry

  • Functional validation:

    • Site-directed mutagenesis of identified PTM sites followed by functional assays

    • In vitro reconstitution experiments with and without specific modifications

When investigating CP47 PTMs in Aethionema grandiflora, researchers should pay particular attention to the modification patterns under different environmental stresses, as these may reveal species-specific adaptation mechanisms that could differ from model plants due to the arid habitat preferences of this species .

What expression systems are optimal for producing recombinant Aethionema grandiflora CP47 protein?

Expressing functional recombinant CP47 from Aethionema grandiflora presents significant challenges due to its membrane-integrated nature, multiple transmembrane domains, and requirement for chlorophyll cofactors. Based on comparative studies with similar photosynthetic proteins, the following expression systems offer distinct advantages:

  • Cyanobacterial expression systems:

    • Advantages: Native photosynthetic machinery; natural chlorophyll synthesis; proper membrane integration

    • Methodology: Replace the endogenous psbB gene in Synechocystis 6803 with the Aethionema grandiflora variant using homologous recombination

    • Optimization considerations: Codon optimization may be necessary; temperature adjustment to 25°C typically improves expression

  • Chloroplast transformation in model plants:

    • Advantages: Authentic processing environment; native cofactor availability

    • Methodology: Transform tobacco or Chlamydomonas reinhardtii chloroplasts using particle bombardment with constructs containing the Aethionema psbB flanked by homologous sequences

    • Considerations: Homoplasmy must be achieved through several rounds of selection

  • Cell-free expression systems:

    • Advantages: Rapid production; avoidance of toxicity issues

    • Methodology: Use chloroplast extracts supplemented with thylakoid membranes and chlorophyll precursors

    • Limitations: Limited post-translational processing; challenging membrane integration

For functional studies, the cyanobacterial system typically yields the most authentic protein structure, particularly when using a psbB knockout strain complemented with the Aethionema variant. When implementing this approach, researchers should monitor expression using both immunological detection (Western blotting) and functional assessment (oxygen evolution measurements), as successful expression does not always correlate with functional integration into Photosystem II complexes .

What are the key considerations for designing site-directed mutagenesis experiments targeting CP47 histidine residues?

When designing site-directed mutagenesis experiments targeting the histidine residues in CP47 from Aethionema grandiflora, researchers should consider several critical factors to ensure meaningful results:

  • Target selection strategy:

    • Focus on the five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions, as these are the primary candidates for chlorophyll binding

    • Prioritize highly conserved histidines first, followed by those showing species-specific variations

    • Design a systematic approach examining single, double, and combinatorial mutations to assess cooperative effects

  • Substitution choice rationale:

    • Conservative substitutions: Replace histidines with asparagine or glutamine to maintain hydrogen bonding but eliminate metal coordination

    • Disruptive substitutions: Replace with alanine or leucine to assess the importance of both the imidazole ring and hydrogen bonding

    • Consider maintaining similar hydropathy profiles to minimize structural disruption unrelated to the specific function being tested

  • Experimental controls:

    • Include mutations of non-conserved residues as negative controls

    • Test equivalent mutations in model organisms where complementation systems are well-established

    • Create revertant strains to confirm phenotype-genotype relationships

  • Functional assessment hierarchy:

    • Primary screening: Growth phenotypes and basic photosynthetic parameters

    • Secondary analysis: Oxygen evolution, fluorescence induction, thermoluminescence

    • Tertiary characterization: Complex assembly analysis, chlorophyll binding quantification, electron transfer kinetics

For data interpretation, it's essential to distinguish between direct effects on chlorophyll binding versus indirect effects on protein folding or complex assembly. Combining spectroscopic techniques (particularly circular dichroism and absorption spectroscopy) with biochemical analyses provides the most comprehensive assessment of mutation impacts .

How can researchers effectively analyze the impact of clpP-psbB intergenic region variations on psbB expression?

Analysis of the clpP-psbB intergenic region's impact on psbB expression requires a multifaceted approach combining comparative genomics, transcriptional analysis, and functional validation. The following methodology is recommended based on observed relationships between intergenic region variations and psbB expression in related systems:

  • Comparative sequence analysis:

    • Align the clpP-psbB intergenic regions from multiple Brassicaceae species, highlighting insertions, deletions, and sequence variations

    • Identify potential regulatory elements, including promoters, enhancers, and transcription factor binding sites

    • Pay particular attention to deletions that might affect spacing between regulatory elements, as seen in the plastome I-specific deletion associated with down-regulated psbB expression

  • Transcriptional analysis:

    • Quantify psbB transcript levels using RT-qPCR with multiple reference genes for normalization

    • Perform 5' RACE to map transcription start sites and identify potential alternative promoters

    • Assess transcript processing and stability through northern blotting and RNA decay assays

    • Compare transcript levels with protein abundance using western blotting with antibodies against CP47

  • Functional validation approaches:

    • Develop reporter gene constructs containing variant intergenic regions fused to a reporter (GFP or LUC)

    • Create synthetic constructs with systematic mutations in putative regulatory elements

    • Consider chloroplast transformation experiments replacing the native intergenic region with variant sequences

Research in Oenothera has demonstrated that a specific deletion in the clpP-psbB spacer correlates with down-regulation of psbB transcripts, reduced CP47 polypeptide levels, and compromised photosystem II function . This suggests that seemingly minor variations in this intergenic region can have profound effects on protein expression and photosynthetic efficiency. When analyzing such variations in Aethionema grandiflora, researchers should consider whether observed differences represent species-specific adaptations or potentially deleterious mutations that might affect photosynthetic performance.

How does CP47 structure and function in Aethionema grandiflora potentially differ from that in model plant species given its adaptation to arid environments?

Aethionema grandiflora's adaptation to arid, high-light environments may be reflected in specialized modifications to its CP47 protein structure and function. As a drought-resistant perennial that thrives in sunny, dry conditions , this species likely has evolved specific photosynthetic adaptations that could manifest in its CP47 protein:

  • Potential structural adaptations:

    • Modified hydrophobic domains that maintain membrane integrity under dehydration stress

    • Altered chlorophyll binding sites that might optimize light harvesting while minimizing photodamage in high-light environments

    • Potentially unique amino acid substitutions in regions involved in protein-protein interactions within the PSII complex

  • Functional implications:

    • Possibly enhanced stability of the CP47-D1 interface to improve PSII repair cycle efficiency under stress conditions

    • Modified energy transfer properties that could reduce excitation pressure under excess light

    • Potentially altered redox properties that might influence susceptibility to photoinhibition

Research investigating these adaptations should employ a combination of molecular dynamics simulations to predict structural differences, followed by experimental validation using recombinant proteins expressed in model systems under variable environmental conditions that mimic the natural habitat of Aethionema grandiflora.

What methodologies can be used to investigate the evolutionary significance of psbB variations across Brassicaceae with Aethionema serving as an outgroup?

To investigate the evolutionary significance of psbB variations across Brassicaceae with Aethionema as an outgroup, researchers should implement a comprehensive evolutionary genomics approach:

  • Phylogenomic framework development:

    • Sequence the psbB gene and flanking regions from diverse Brassicaceae species representing major lineages

    • Include multiple Aethionema species (A. grandiflorum, A. cordifolium) as established outgroups

    • Construct robust phylogenetic trees using maximum likelihood, Bayesian inference, and parsimony methods

    • Calculate evolutionary distances between plastomes to establish divergence timelines

  • Selection pressure analysis:

    • Calculate dN/dS ratios across the entire gene and within specific functional domains

    • Apply site-specific and branch-specific models to identify regions under positive, negative, or relaxed selection

    • Implement tests for episodic selection using methods like MEME (Mixed Effects Model of Evolution)

    • Compare selection patterns in psbB with other photosystem genes to identify co-evolutionary patterns

  • Structure-function correlation approaches:

    • Map sequence variations onto predicted protein structures to identify functionally significant changes

    • Focus particularly on changes that might affect chlorophyll binding histidine residues or their spacing

    • Analyze covariation patterns that might indicate compensatory mutations maintaining functional constraints

  • Experimental validation of evolutionary hypotheses:

    • Express ancestral and derived CP47 variants in model systems to test functional differences

    • Perform comparative biochemical analyses to determine if variations alter protein stability, chlorophyll binding affinity, or energy transfer efficiency

This approach has proven effective in related studies of chloroplast genome evolution. For instance, research on Brassicaceae has identified twelve chloroplast genes with signatures of positive selection at the family-wide level . Determining whether psbB is among these or shows lineage-specific patterns of selection would provide valuable insights into the evolutionary forces shaping photosynthetic machinery across drought-adapted versus mesic-adapted lineages.

How can researchers investigate potential interactions between nuclear-encoded factors and the psbB gene in Aethionema grandiflora?

Investigating nuclear-encoded factors that interact with the psbB gene and its product in Aethionema grandiflora requires approaches that bridge chloroplast and nuclear genome functions. Based on established research in plastid-nuclear interactions, the following methodological framework is recommended:

  • Identification of candidate nuclear factors:

    • Mining transcriptome data for nuclear genes encoding known CP47 interaction partners

    • Comparative expression analysis of nuclear genes involved in chloroplast biogenesis between compatible and incompatible plastid-nuclear combinations

    • Screening for nuclear-encoded sigma factors that might regulate psbB expression

    • Analysis of nuclear genes encoding Photosystem II assembly factors specific to CP47 integration

  • Co-expression analysis approaches:

    • RNA-seq analysis under various environmental conditions to identify nuclear genes whose expression correlates with psbB

    • Reverse genetics approaches in model systems to validate candidate genes

    • Development of tissue-specific and developmental transcriptome datasets to map expression networks

  • Protein-protein interaction studies:

    • Pull-down assays using tagged CP47 to identify interacting nuclear-encoded proteins

    • Yeast two-hybrid screening with CP47 domains as bait

    • Split-GFP complementation assays to confirm interactions in planta

    • Co-immunoprecipitation followed by mass spectrometry to identify the CP47 interactome

  • Plastid-nuclear incompatibility models:

    • Investigation of potential incompatibilities between Aethionema nuclear factors and psbB from other species

    • Analysis of hybrid plants with mixed plastid-nuclear backgrounds to identify communication disruptions

    • Examination of transcript processing, protein stability, and complex assembly in compatible versus incompatible combinations

Research in Oenothera has demonstrated that plastid-genome incompatibility (PGI) can manifest through disrupted interactions between nuclear and plastid genomes, affecting processes like RNA processing and protein complex assembly . In particular, the clpP-psbB intergenic region appears to be a hotspot for changes that can influence compatibilities between nuclear and plastid genomes . Similar mechanisms might operate in Aethionema and could be particularly relevant when considering its evolutionary position as an outgroup to core Brassicaceae.

What are the most effective approaches for troubleshooting low expression or instability of recombinant CP47 protein?

Troubleshooting low expression or instability of recombinant CP47 from Aethionema grandiflora requires a systematic approach addressing multiple potential bottlenecks in the expression and purification process:

  • Expression system optimization:

    • Problem: Standard E. coli systems often fail with membrane proteins containing multiple transmembrane domains

    • Solution: Use specialized strains designed for membrane protein expression (C41/C43) or switch to photosynthetic hosts like Synechocystis where the native machinery for CP47 integration exists

    • Approach: Test expression with different promoter strengths and induction conditions; consider lower temperatures (16-25°C) to slow folding and improve membrane integration

  • Construct design refinement:

    • Problem: Full-length protein including transit peptides can cause folding issues

    • Solution: Remove predicted transit peptides and optimize the N-terminus based on mature protein sequences

    • Approach: Create a series of N-terminal variants with different start points to identify optimal expression constructs

  • Stability enhancement strategies:

    • Problem: CP47 is unstable without its native lipid environment and chlorophyll cofactors

    • Solution: Co-express chlorophyll biosynthesis genes or supplement growth media with chlorophyll precursors

    • Approach: Include detergents known to stabilize membrane proteins (DDM, LMNG) in all buffers; consider adding lipids that mimic the thylakoid membrane environment

  • Purification protocol optimization:

    • Problem: Standard affinity tags may interfere with folding or be inaccessible

    • Solution: Test multiple tag positions (N-terminal, C-terminal, internal loops) and different tag types

    • Approach: Implement mild solubilization conditions using styrene maleic acid lipid particles (SMALPs) to extract protein with its native lipid environment

When working specifically with Aethionema grandiflora CP47, researchers should be aware that its adaptation to arid environments might result in protein characteristics that differ from model systems. This could necessitate adjustments to expression conditions, particularly temperature ranges and ionic strengths that mimic its native cellular environment.

How can researchers overcome challenges in analyzing CP47-chlorophyll interactions in recombinant systems?

Analyzing CP47-chlorophyll interactions presents significant challenges due to the complexity of chlorophyll incorporation and the protein's membrane-integrated nature. The following strategies can help overcome these obstacles:

  • Chlorophyll incorporation approaches:

    • In vivo strategies: Express CP47 in photosynthetic organisms (cyanobacteria, algae) where chlorophyll biosynthesis occurs naturally

    • Reconstitution methods: Isolate apoprotein and perform controlled reconstitution with purified chlorophyll under optimized conditions

    • Co-expression systems: Engineer expression hosts to co-produce chlorophyll biosynthetic enzymes alongside CP47

  • Spectroscopic analysis techniques:

    • Absorption spectroscopy: Monitor characteristic chlorophyll absorption peaks (particularly the red region) to assess binding

    • Circular dichroism (CD): Examine induced CD signals resulting from protein-bound chlorophylls in specific orientations

    • Time-resolved fluorescence: Measure energy transfer kinetics within the protein to map chlorophyll-chlorophyll interactions

    • Resonance Raman spectroscopy: Identify specific chlorophyll-protein interactions through vibrational coupling

  • Structural characterization approaches:

    • Cryo-electron microscopy: Visualize chlorophyll molecules within the protein structure at near-atomic resolution

    • Mass spectrometry with crosslinking: Identify chlorophyll binding sites through specialized MS techniques

    • Hydrogen-deuterium exchange: Map regions protected by chlorophyll binding

  • Mutagenesis validation strategy:

    • Target the five pairs of histidine residues spaced by 13-14 amino acids in hydrophobic regions

    • Create systematic substitutions and measure effects on chlorophyll binding and spectroscopic properties

    • Develop a comprehensive binding site map through correlation of mutagenesis data with spectroscopic results

When working specifically with Aethionema grandiflora CP47, researchers should consider that potential adaptations to high-light, arid environments might manifest as subtle differences in chlorophyll binding properties compared to mesic species. These could include altered chlorophyll a/b ratios, modified energy transfer characteristics, or enhanced photoprotective mechanisms within the protein structure.

What methodological approaches can resolve contradictory data on psbB expression and CP47 function across different experimental systems?

When faced with contradictory data regarding psbB expression or CP47 function across different experimental systems, researchers should implement a systematic troubleshooting and validation strategy:

  • Standardization and calibration:

    • Expression analysis standardization: Use multiple reference genes for RT-qPCR normalization; apply absolute quantification where possible

    • Protein quantification calibration: Develop standard curves with purified recombinant protein; use multiple antibodies targeting different epitopes

    • Functional assay benchmarking: Compare relative versus absolute measurements; standardize against wild-type controls under identical conditions

  • Cross-validation through methodological triangulation:

    • Expression level verification: Compare results from RT-qPCR, RNA-seq, northern blotting, and polysome profiling

    • Protein abundance confirmation: Cross-validate western blotting with mass spectrometry-based quantification and in vivo fluorescent tagging

    • Functional analysis integration: Combine oxygen evolution measurements, chlorophyll fluorescence, and spectroscopic analyses

  • Biological context consideration:

    • Developmental timing: Examine expression and function across different developmental stages

    • Environmental conditions: Systematically vary light intensity, temperature, and water availability to identify condition-dependent variations

    • Tissue specificity: Compare results from different tissue types and cell-specific analyses

  • Meta-analysis framework:

    • Develop a comprehensive dataset integrating results from all available systems

    • Apply statistical approaches specifically designed for meta-analysis of heterogeneous data

    • Identify patterns of variation that might indicate biological significance versus methodological artifacts

A particularly valuable approach when studying CP47 in Aethionema grandiflora would be to examine potential environmental influence on experimental outcomes. Given its adaptation to arid, high-light environments , CP47 expression and function might be particularly sensitive to light intensity and water availability during experiments. For instance, research in Oenothera revealed that a deletion in the clpP-psbB spacer resulted in down-regulation of psbB transcripts and reduced CP47 protein levels , but the severity of this effect might vary across experimental conditions.

How might CRISPR-Cas9 technology be applied to study psbB function in Aethionema grandiflora?

CRISPR-Cas9 technology offers unprecedented opportunities for precise genetic manipulation of the psbB gene in Aethionema grandiflora, enabling detailed functional studies previously impossible in non-model organisms. The following strategic approaches are recommended:

  • Chloroplast genome editing strategies:

    • Direct chloroplast transformation: Adapt biolistic transformation protocols used in tobacco for Aethionema tissue culture

    • CRISPR-Cas9 delivery: Develop plastid-targeted CRISPR-Cas9 systems with customized guide RNAs for the psbB locus

    • Homology-directed repair templates: Design templates with desired mutations flanked by homologous sequences for precise editing

  • Key experimental applications:

    • Site-directed mutagenesis: Introduce precise mutations in histidine residues suspected to be involved in chlorophyll binding

    • Domain swapping: Replace specific domains with equivalents from other species to map functional regions

    • Reporter integration: Insert fluorescent or enzymatic reporters to track expression in vivo

    • Promoter engineering: Modify the clpP-psbB intergenic region to investigate regulatory mechanisms

  • Validation approaches:

    • Segregation analysis: Confirm homoplasmy through multiple regeneration cycles

    • Phenotypic characterization: Assess photosynthetic efficiency, growth patterns, and stress responses

    • Molecular profiling: Analyze transcriptome and proteome changes resulting from psbB modifications

  • Technical considerations specific to Aethionema:

    • Develop optimized tissue culture and regeneration protocols for this non-model species

    • Establish transformation efficiency baselines through preliminary experiments with marker genes

    • Consider potential polyploidy or genomic complexities that might affect editing outcomes

Given that Aethionema species serve as important evolutionary outgroups in Brassicaceae phylogeny , CRISPR-edited variants could provide crucial insights into the evolutionary trajectory of photosynthetic machinery across the family. Comparing the effects of identical mutations in Aethionema versus core Brassicaceae members would be particularly valuable for understanding how photosynthetic components have adapted to different ecological niches.

What novel insights might structural biology approaches provide about CP47 from Aethionema grandiflora?

Advanced structural biology approaches could reveal critical insights about Aethionema grandiflora CP47 that go beyond sequence information to illuminate functional adaptations specific to this drought-adapted species:

  • Cutting-edge structural determination techniques:

    • Cryo-electron microscopy: Achieve near-atomic resolution of the entire Photosystem II complex containing CP47

    • Solid-state NMR: Characterize specific chlorophyll-protein interactions and dynamic aspects not visible in static structures

    • X-ray free electron laser (XFEL) crystallography: Capture transient states during energy transfer and photochemical reactions

    • Integrative structural biology: Combine multiple experimental techniques with computational modeling

  • Key structural features to investigate:

    • Chlorophyll binding pocket architecture: Compare geometries with mesic species to identify potential adaptations for high-light environments

    • Protein dynamics under dehydration: Examine structural stability under conditions mimicking water stress

    • Interface regions with other PSII subunits: Identify potentially unique interaction surfaces that might affect complex assembly or stability

    • Water molecule networks: Map internal water channels that might influence proton movement or structural flexibility

  • Functional correlations with structure:

    • Structure-guided mutagenesis: Design precise mutations based on structural insights to test specific hypotheses

    • Molecular dynamics simulations: Model protein behavior under different environmental conditions

    • Quantum mechanical calculations: Predict energy transfer pathways based on chlorophyll positions and orientations

  • Comparative structural biology:

    • Analyze structural differences between Aethionema grandiflora CP47 and homologs from diverse species

    • Focus particularly on regions showing evidence of positive selection or adaptive evolution

    • Correlate structural variations with ecological adaptations across Brassicaceae species

This approach could reveal how Aethionema grandiflora's adaptation to arid, high-light environments might be reflected in subtle but functionally significant structural adaptations of its photosynthetic machinery. For instance, specific amino acid substitutions might alter the microenvironment around chlorophyll molecules, potentially optimizing light harvesting while minimizing photodamage under intense sunlight conditions characteristic of its natural habitat.

How might integrating transcriptomics, proteomics, and metabolomics enhance our understanding of psbB regulation in Aethionema grandiflora?

Integrating multi-omics approaches can provide a comprehensive systems biology view of psbB regulation in Aethionema grandiflora, revealing complex regulatory networks and adaptive mechanisms that single-omics approaches might miss:

  • Multi-omics experimental design:

    • Synchronized sampling: Collect material for all omics analyses from identical plants under controlled conditions

    • Environmental gradient experiments: Apply gradual changes in light intensity, temperature, and water availability to capture dynamic responses

    • Developmental time series: Track changes across key developmental stages from seedling to mature plant

    • Comparative framework: Include other Brassicaceae species spanning the phylogenetic spectrum

  • Integrated analytical approaches:

    • Transcriptome analysis: RNA-seq with specific enrichment for chloroplast transcripts; targeted analysis of psbB expression patterns

    • Proteome characterization: Quantitative proteomics with emphasis on thylakoid membrane complexes and CP47 interacting partners

    • Metabolome profiling: Focus on photosynthesis-related metabolites, particularly chlorophyll biosynthesis intermediates and products

    • Lipidome examination: Analyze thylakoid membrane composition that might influence CP47 stability and function

  • Integration and network analysis:

    • Multi-omics data integration: Apply statistical frameworks specifically designed for heterogeneous data types

    • Network reconstruction: Build regulatory networks centered on psbB/CP47

    • Machine learning applications: Implement supervised and unsupervised learning approaches to identify patterns across data types

    • Causal modeling: Infer directional relationships between regulatory elements and psbB expression

  • Specific research questions addressable through this approach:

    • How do nuclear-encoded factors coordinate with plastid-encoded components to regulate psbB expression?

    • What metabolic feedback mechanisms influence CP47 synthesis and turnover?

    • How does environmental stress reconfigure the regulatory networks controlling photosynthetic machinery?

    • Are there species-specific regulatory mechanisms in Aethionema that might relate to its evolutionary position or ecological adaptation?

This integrated approach is particularly valuable for understanding how Aethionema grandiflora, adapted to arid environments , might employ unique regulatory mechanisms for photosynthetic components. For instance, investigation of the clpP-psbB intergenic region, which has been implicated in expression regulation in other species , might reveal adaptive modifications that enable optimal photosynthetic efficiency under water-limited conditions typical of Aethionema's natural habitat.

What are the most significant unanswered questions regarding Aethionema grandiflora psbB that future research should address?

Several critical knowledge gaps remain in our understanding of the psbB gene and CP47 protein in Aethionema grandiflora that warrant focused research attention:

  • Evolutionary significance:

    • How does the sequence and function of psbB in Aethionema, as an early-diverging lineage, inform our understanding of photosynthetic evolution across Brassicaceae?

    • What selection pressures have shaped psbB evolution in Aethionema compared to core Brassicaceae members?

    • Does the evolutionary history of psbB correlate with ecological adaptation patterns across the family?

  • Regulatory mechanisms:

    • What specific elements in the clpP-psbB intergenic region control expression in Aethionema grandiflora?

    • How do nuclear factors interact with these regulatory regions?

    • Are there species-specific regulatory mechanisms that reflect adaptation to arid environments?

  • Structural and functional adaptations:

    • Do the chlorophyll binding properties of Aethionema CP47 show adaptations to high-light environments?

    • How does the protein's stability under water-limited conditions compare to mesic species?

    • Are there unique post-translational modifications that influence function?

  • Intergenomic interactions:

    • What potential incompatibilities might exist between Aethionema plastids and nuclear genomes from other Brassicaceae?

    • How have nuclear and plastid genomes co-evolved to maintain optimal photosynthetic function?

    • Could Aethionema provide insights into the mechanisms underlying plastid-genome incompatibility observed in other systems?

Addressing these questions will not only advance our understanding of this specific protein but could provide broader insights into photosynthetic adaptation and evolution. The positioning of Aethionema as an evolutionary outgroup to core Brassicaceae , combined with its adaptation to arid environments , makes it particularly valuable for comparative studies of photosynthetic machinery across ecological gradients.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.