Recombinant Aethionema grandiflora Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

Photosystem Q(B) is a core subunit of PSII, mediating electron transfer from the reaction center to plastoquinone (Q(B) site). It plays a pivotal role in:

Comparative Analysis with Other PSII Proteins

The Q(B) protein shares functional similarities with other PSII subunits, such as D2 (psbD), but differs in structural specialization:

FeatureQ(B) Protein (psbA)D2 Protein (psbD)
Primary RoleQuinone binding and electron transferReaction center stabilization
Subcellular LocationThylakoid membraneThylakoid membrane
TagN-terminal His (variable)N-terminal His
Source OrganismAethionema grandifloraAethionema grandiflora
Expression SystemE. coliE. coli

Data compiled from product specifications .

Research Applications

Recombinant Q(B) protein is utilized in:

  • Structural Biology: Crystallization studies to resolve PSII architecture .

  • ELISA Development: Detection of PSII subunits in plant extracts .

  • Functional Assays: Investigating electron transfer kinetics and herbicide resistance mechanisms .

Genomic and Evolutionary Context

While Helitron transposons are known to influence gene evolution in Brassicaceae (e.g., Brassica napus), their impact on psbA in Aethionema remains unexplored . Future studies may address whether transposon insertions near psbA contribute to photosynthetic adaptation.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, if you have specific requirements for the format, please indicate your needs when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Aethionema grandiflorum (Persian stone-cress)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the Photosystem Q(B) protein differ from the Photosystem Q(A) protein?

While both proteins are essential components of Photosystem II and share the same EC number (1.10.3.9), they have distinct sequences and functions:

FeaturePhotosystem Q(B) proteinPhotosystem Q(A) protein
Alternative namePhotosystem II protein D1Photosystem II D2 protein
GenepsbApsbD
UniProt IDA4QJI0A4QJJ4
Length344 amino acids353 amino acids
FunctionPrimary electron acceptor in PSIISecondary electron acceptor in PSII

The D1 protein (Q(B)) forms the reaction center of PSII along with the D2 protein (Q(A)), but they bind different electron acceptors and have evolved to perform complementary roles in photosynthetic electron transport .

What are the optimal storage conditions for recombinant Aethionema grandiflora Photosystem Q(B) protein?

For optimal stability and activity preservation of recombinant Photosystem Q(B) protein:

  • Store the protein at -20°C for regular use

  • For extended storage, maintain at -20°C or -80°C

  • Prepare the protein in Tris-based buffer with 50% glycerol optimized for stability

  • Avoid repeated freezing and thawing cycles as this significantly reduces protein activity

  • For short-term work (up to one week), working aliquots can be stored at 4°C

  • When handling the protein, minimize exposure to light to prevent photooxidation

These storage recommendations are similar to those for other recombinant photosynthetic proteins and are designed to maintain structural integrity and functional activity.

What techniques are most effective for analyzing Photosystem Q(B) protein interactions in chloroplast complexes?

Multiple complementary techniques have proven effective for studying Photosystem Q(B) protein interactions:

  • BN/SDS-PAGE (Blue Native/SDS-Polyacrylamide Gel Electrophoresis):

    • Particularly useful for resolving hydrophobic membrane protein complexes

    • Maintains the native state of protein complexes in the first dimension

    • Allows for analysis of subunit composition in the second dimension

    • Has successfully identified Photosystem II proteins in complex with other components

  • IEF/SDS-PAGE with DIGE technology:

    • More suitable for soluble and peripheral membrane proteins

    • Less effective for highly hydrophobic membrane proteins like Photosystem Q(B)

    • Provides quantitative analysis when combined with differential gel electrophoresis (DIGE)

  • Additional techniques commonly employed:

    • Mass spectrometry for protein identification

    • Chlorophyll fluorescence measurements to assess functional state

    • Electron microscopy to visualize complex formation

    • Cross-linking studies to identify direct interaction partners

Research has shown that combining BN/SDS-PAGE with other techniques provides the most comprehensive analysis of Photosystem II protein complexes and their associations with other photosynthetic components .

How can researchers experimentally distinguish between the activities of recombinant and native Photosystem Q(B) protein?

To distinguish between recombinant and native Photosystem Q(B) protein activities, researchers can implement several methodological approaches:

  • Spectroscopic Analysis:

    • Measure electron transfer rates using absorption spectroscopy

    • Compare chlorophyll fluorescence induction curves

    • Assess oxygen evolution rates in reconstitution experiments

  • Biochemical Comparison:

    • Perform differential sensitivity testing to known PSII inhibitors

    • Compare turnover rates under varying light conditions

    • Analyze redox potential differences using specialized electrodes

  • Tag-Based Differentiation:

    • Incorporate detection tags in recombinant proteins that don't interfere with function

    • Use tag-specific antibodies for Western blot analysis

    • Employ affinity purification to isolate recombinant protein complexes

  • Reconstitution Studies:

    • Introduce recombinant protein into native membranes lacking the protein

    • Measure restoration of electron transport activity

    • Compare activity recovery percentages to benchmark native function

A comprehensive approach combining these methods provides the most reliable differentiation between recombinant and native protein activities.

What are the current methodologies for using recombinant photosystem proteins to study photosynthetic electron transport chain disorders?

Current methodologies employ recombinant photosystem proteins as powerful tools for understanding electron transport chain disorders:

  • Protein Replacement Studies:

    • Direct administration of recombinant photosystem proteins to isolated chloroplasts

    • Liposome-mediated delivery to ensure targeted incorporation

    • Measurement of functional restoration using electron transport assays

  • Site-Directed Mutagenesis Approaches:

    • Generation of recombinant protein variants with specific mutations

    • Expression and purification using optimized protocols

    • Functional characterization to identify critical residues for electron transport

    • Comparative analysis with wild-type protein to quantify functional impact

  • Cross-Species Complementation:

    • Introduction of Aethionema grandiflora Photosystem Q(B) protein into other species

    • Assessment of functional compatibility and efficiency

    • Identification of species-specific interaction partners

  • Systems Biology Integration:

    • Quantitative proteomics to measure protein complex stoichiometry

    • Network analysis of photosystem protein interactions

    • Mathematical modeling of electron flow with altered components

These methodologies have been successfully applied in recent studies of photoreceptor proteins. For example, research has demonstrated that both direct and liposome-mediated protein delivery can target signaling cascades in neuronal cells, which offers promising approaches for studying photosynthetic proteins as well .

How can researchers optimize expression and purification protocols for obtaining functionally active recombinant Photosystem Q(B) protein?

Optimization of expression and purification protocols for Photosystem Q(B) protein requires addressing several critical challenges:

  • Host Selection and Modification:

    • Escherichia coli strains optimized for membrane protein expression (C41, C43)

    • Chaperone co-expression systems to assist proper folding

    • Use of specialized chloroplast-mimicking expression hosts

    • Controlled expression temperature (typically 18-25°C) to reduce inclusion body formation

  • Vector Design Considerations:

    • Codon optimization based on expression host

    • Selection of appropriate solubilization tags (His, MBP, GST)

    • Incorporation of cleavable tags that don't interfere with protein function

    • Careful design of construct boundaries to maintain transmembrane domains

  • Membrane Protein Solubilization:

    • Screening of detergent panels (DDM, LMNG, digitonin)

    • Use of amphipols or nanodiscs for stabilization

    • Implementation of lipid supplementation during purification

    • Gradual detergent exchange methods to maintain native-like environment

  • Functional Assessment Protocols:

    • Circular dichroism to confirm secondary structure

    • Binding assays with known interaction partners

    • Electron transport activity measurements

    • Reconstitution into liposomes for functional tests

  • Storage Optimization:

    • 50% glycerol in Tris-based buffer

    • Storage at -20°C or -80°C for extended preservation

    • Aliquoting to avoid freeze-thaw cycles

    • Addition of specific lipids to maintain stability

Implementing these optimizations requires systematic testing and validation, but significantly improves the yield and quality of functionally active recombinant Photosystem Q(B) protein.

What evidence exists for post-translational modifications of Photosystem Q(B) protein in Aethionema grandiflora and related species?

Analysis of post-translational modifications (PTMs) in Photosystem Q(B) protein reveals several regulatory mechanisms:

  • Phosphorylation Events:

    • N-terminal threonine phosphorylation under high light conditions

    • Regulatory role in PSII repair cycle and photoinhibition response

    • Differential phosphorylation patterns between species adapted to various light environments

  • Oxidative Modifications:

    • Carbonylation of specific residues during photoinhibition

    • Methionine oxidation as both damage marker and regulatory mechanism

    • Higher oxidation susceptibility in specific protein regions

  • Proteomic Evidence:

    • Mass spectrometry studies have identified multiple PTM sites in Brassicaceae species

    • Comparison between Aethionema grandiflora and other species shows conservation of key modification sites

    • Environmental stress conditions alter the PTM profile of Photosystem Q(B) protein

  • Functional Consequences:

    • Modifications regulate protein turnover rate

    • Affect protein-protein interactions within the PSII complex

    • Modulate electron transfer efficiency under varying conditions

Research on Cardamine species suggests that high-altitude adaptation has influenced the evolution of these regulatory mechanisms, with evidence of positive selection in genes involved in photosynthesis regulation, potentially including those controlling post-translational modifications .

How does research on Aethionema grandiflora Photosystem Q(B) protein contribute to understanding evolutionary adaptations in the Brassicaceae family?

Research on Aethionema grandiflora Photosystem Q(B) protein provides valuable insights into evolutionary adaptations within Brassicaceae:

  • Phylogenetic Significance:

    • Aethionema is positioned at a basal branch in the Brassicaceae family

    • Comparative analysis of its photosystem proteins helps trace evolutionary trajectories

    • Serves as an important reference point for understanding photosynthetic adaptations

  • Adaptive Evolution Evidence:

    • Studies have identified 12 photosynthesis-related genes with signatures of positive selection at the family-wide level

    • Comparison of codon usage patterns between related species reveals evolutionary pressures

    • High-altitude species show accelerated evolution in cold-responsive genes, including photosystem components

  • Structural Conservation Analysis:

    • Core functional domains show high conservation across Brassicaceae

    • Variable regions correlate with specific environmental adaptations

    • Comparison with other species helps identify critical vs. adaptable protein regions

  • Integration with Genome Evolution:

    • Whole genome duplication (WGD) events in Brassicaceae have influenced photosystem gene evolution

    • Multiple independent WGD events detected in Cleomaceae, Capparaceae, and Resedaceae may have impacted photosystem protein diversity

    • Synteny analysis of photosystem genes reveals patterns of genome rearrangement

Through these approaches, research on Photosystem Q(B) protein contributes to our understanding of how environmental pressures have shaped the evolution of photosynthetic machinery across the Brassicaceae family.

What methodological approaches can researchers use to study the effects of environmental stress on Photosystem Q(B) protein function and turnover?

Researchers can employ several methodological approaches to investigate environmental stress effects on Photosystem Q(B) protein:

  • Controlled Environmental Systems:

    • Growth chambers with programmable temperature, light, and humidity

    • Field-to-lab transition studies using transplanted specimens

    • Common garden experiments comparing different ecotypes under identical stress conditions

  • Molecular Stress Response Analysis:

    • Real-time quantitative PCR to measure transcriptional responses

    • Western blot analysis with specific antibodies to track protein abundance

    • Pulse-chase labeling to measure protein turnover rates under stress

    • BN/SDS-PAGE to analyze changes in protein complex composition

  • Functional Assessment Techniques:

    • Chlorophyll fluorescence measurements (OJIP test) to assess PSII efficiency

    • P700 absorbance changes to measure PSI activity

    • Oxygen evolution measurements under varying stress conditions

    • Electron paramagnetic resonance (EPR) to track electron transfer events

  • Integrated Omics Approaches:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlation analysis between gene expression and protein abundance

    • Network analysis to identify stress-responsive regulatory hubs

    • Comparative analysis between stress-tolerant and sensitive species

Studies on Cardamine species provide a valuable model, as research has shown significant differences in how high-altitude (C. resedifolia) and low-altitude (C. impatiens) species respond to environmental stressors at the molecular level, particularly in terms of photosynthetic gene evolution and expression patterns .

What are the emerging techniques for studying protein-protein interactions involving Photosystem Q(B) protein in native and recombinant systems?

Emerging techniques for studying Photosystem Q(B) protein interactions represent significant methodological advances:

  • Single-Molecule Approaches:

    • Förster resonance energy transfer (FRET) between labeled protein partners

    • Atomic force microscopy to visualize complex formation in membrane environments

    • Single-molecule tracking to observe dynamic interactions in reconstituted systems

  • Advanced Structural Biology Methods:

    • Cryo-electron microscopy for high-resolution structural determination

    • Integrative structural biology combining multiple data sources

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Time-resolved crystallography to capture transient interaction states

  • In Situ Techniques:

    • Proximity labeling methods (BioID, APEX) to identify interaction partners in native environments

    • In-cell NMR to detect structural changes upon interaction

    • Super-resolution microscopy to visualize protein co-localization in chloroplasts

  • Computational Approaches:

    • Molecular dynamics simulations of protein-protein docking

    • Machine learning algorithms to predict interaction networks

    • Systems biology modeling of dynamic protein complex assembly

  • Recombinant Protein Delivery Systems:

    • Liposome-mediated protein delivery for in vivo studies

    • Cell-penetrating peptide fusions for protein internalization

    • Nanoparticle-based delivery systems with targeting capabilities

Recent research has demonstrated the feasibility of liposome-mediated protein delivery for modulating signaling cascades in complex cellular environments, suggesting similar approaches could be valuable for studying photosystem proteins .

How can understanding Photosystem Q(B) protein contribute to developing drought-resistant or high-altitude adapted crops?

Understanding Photosystem Q(B) protein's structure, function, and adaptations provides several pathways toward developing stress-resilient crops:

  • Comparative Genomics Approach:

    • Identify natural variants in drought-resistant or high-altitude species

    • Map adaptive mutations in Photosystem Q(B) protein across Brassicaceae

    • Target specific amino acid changes associated with stress tolerance

    • Use evolutionary analysis to distinguish adaptive from neutral changes

  • Functional Testing Methodology:

    • Express variant forms in model systems

    • Measure photosynthetic efficiency under stress conditions

    • Quantify protein damage rates and turnover under adverse conditions

    • Assess electron transport chain stability with modified components

  • Applied Breeding Strategies:

    • Develop molecular markers for beneficial Photosystem Q(B) variants

    • Implement marker-assisted selection in breeding programs

    • Screen germplasm collections for naturally stress-adapted variants

    • Combine genomic selection with high-throughput phenotyping

  • Biotechnological Applications:

    • Engineer optimized Photosystem Q(B) variants via precise gene editing

    • Test modified variants in crop systems using transgenic approaches

    • Evaluate whole-plant performance metrics including yield under stress

    • Balance photosynthetic efficiency with stress resilience

Research on Cardamine species provides valuable insights, as studies have shown that high-altitude adapted species (C. resedifolia) exhibit accelerated evolution in cold-responsive genes, including those involved in photosynthesis, compared to low-altitude relatives (C. impatiens) . These natural adaptations offer templates for crop improvement strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.