Recombinant African swine fever virus Cysteine-rich protein E199L (Ken-142)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant African Swine Fever Virus Cysteine-Rich Protein E199L (Ken-142)

Recombinant African swine fever virus Cysteine-rich protein E199L (Ken-142) is a protein crucial for the African swine fever virus (ASFV) entry into host cells . ASFV causes a lethal hemorrhagic disease in pigs, posing a significant threat to the global pig industry . The E199L protein is essential for the virus's ability to fuse with the host cell membrane and penetrate the cell core .

Key Functions and Characteristics

  • Role in Virus Entry: pE199L mediates the entry of ASFV into host cells by facilitating membrane fusion, which is required for the penetration of the virus's core into the host cell .

  • Structural Features: pE199L is a cysteine-rich structural polypeptide, showing similarities to proteins like A16, G9, and J5 of the poxviruses' entry fusion complex (EFC) . It is localized to the inner viral envelope and acts as an integral transmembrane polypeptide with cytosolic intramolecular disulfide bonds .

  • Non-Essential for Assembly and Egress: Research indicates that pE199L is not required for virus assembly, egress, virus-cell binding or endocytosis .

Experimental Findings

Studies using ASFV recombinants that inducibly express the E199L gene have provided critical insights into its function.

FeatureDescription
ExpressionASFV recombinant inducibly expresses the E199L gene .
Virus Assembly and EgresspE199L is not required for these processes .
Virus-Cell BindingpE199L is not essential for the virus to bind to host cells .
EndocytosisThe protein is not needed for endocytosis, the process by which cells internalize substances .
Membrane Fusion and PenetrationpE199L is required for membrane fusion and core penetration, which are critical steps in viral entry .

Implications for Antiviral Strategies

The identification of pE199L's role in viral entry suggests it as a potential target for developing antiviral strategies against ASFV . Understanding the mechanisms of ASFV internalization and the specific functions of proteins like pE199L can aid in designing interventions that block the early stages of ASFV replication .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Ken-142; Cysteine-rich protein E199L; pE199L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Target Names
Ken-142
Target Protein Sequence
MSCTPVSTKCNDIWIDFSCTGPSVSELQKKEPNAWAAILRSQKNQQTAEDDTIIGSICDK QGLCSKDEYAYSQYCACVNSGTLWAECAFAPCNGNKNAYKTTEQRNILTNKQCPSGLTIC QNIAEYGGTGNISDLYQNFNCNSVINTFLINVMNHPFLTLILIILILVIIYRLMSSSAAK QNGDKLPPPSLIFSNLNNF
Uniprot No.

Target Background

Protein Families
Asfivirus E199L family
Subcellular Location
Virion. Host membrane; Single-pass membrane protein. Note=Found in cytoplasmic viral factories during assembly.

Q&A

What is the E199L protein of African swine fever virus and what are its key structural features?

E199L is a structural cysteine-rich protein of African swine fever virus (ASFV) that functions as a transmembrane protein type I harboring disulfide bonds. It is a late-synthesized viral protein that localizes to the inner membrane of the viral particle. The protein shares structural similarity with three poxviral fusion machinery subunits: A16, G9, and A26 . The Ken-142 variant specifically refers to the E199L protein isolated from the Kenyan ASFV strain (isolate Pig/Kenya/KEN-50/1950), which has been recombinantly expressed for research purposes .

What is the primary cellular function of ASFV E199L protein that has been experimentally demonstrated?

Studies have definitively shown that ASFV E199L protein induces a complete autophagy process in both Vero and HEK-293T cells. The protein triggers autophagy as evidenced by the conversion of LC3-I to LC3-II and the degradation of P62, which are classic markers of autophagy activation . Experimental time-course analyses demonstrate that after E199L transfection, significant LC3-I to LC3-II conversion can be detected as early as 12 hours post-transfection, with the effect continuing through 24 and 36 hours . This autophagic response represents a complete process, as confirmed by P62 degradation at later time points (24 and 36 hours) following transfection .

How does E199L interact with host cellular machinery?

Through co-immunoprecipitation coupled with mass spectrometry (CoIP-MS) analysis, researchers have identified that E199L specifically interacts with Pyrroline-5-carboxylate reductase 2 (PYCR2), a host cellular protein . This interaction results in the down-regulation of PYCR2 expression at both mRNA and protein levels . The downregulation of PYCR2 subsequently leads to the activation of autophagy, establishing a mechanistic link between E199L, PYCR2, and cellular autophagy .

What are the recommended expression systems for producing recombinant E199L protein?

Recombinant E199L protein can be successfully produced using Escherichia coli expression systems, as demonstrated by commercial sources offering the protein . For research purposes requiring properly folded protein with disulfide bonds, it's essential to optimize expression conditions to ensure correct protein folding. While E. coli is commonly used, mammalian expression systems may provide advantages for studying the protein's functional characteristics in cellular contexts. When expressing E199L in mammalian cells for functional studies, Flag-tagged expression plasmids have been successfully utilized in transient transfection experiments with Vero and HEK-293T cells .

What are the established methods for detecting and measuring E199L-induced autophagy?

Several complementary techniques have been validated for assessing E199L-induced autophagy:

  • Western blotting - The conversion of LC3-I to LC3-II can be monitored using anti-LC3B antibodies, with densitometric analysis of the LC3-II/LC3-I ratio providing quantitative assessment . Additionally, monitoring P62 degradation (using anti-P62 antibodies) serves as a marker for complete autophagic flux.

  • Confocal microscopy - Visualization of fluorescent LC3B puncta formation in cells transfected with E199L expression plasmids compared to empty vector controls can confirm autophagosome formation .

  • Lysosomal fusion assessment - Lyso-Tracker staining combined with confocal microscopy can be used to determine the fusion between autophagosomes and lysosomes, confirming complete autophagic flux .

The experimental timeline should include multiple time points (6, 12, 24, and 36 hours post-transfection) to capture the full progression of the autophagic response .

How can researchers effectively analyze the interaction between E199L and PYCR2?

To investigate the E199L-PYCR2 interaction, researchers should employ a multi-faceted approach:

  • Co-immunoprecipitation (CoIP) - Using antibodies against either E199L or PYCR2 to pull down protein complexes, followed by western blotting to detect the interacting partner .

  • Mass spectrometry analysis - Following CoIP, mass spectrometry can identify interacting partners with high sensitivity and confirm the specificity of the E199L-PYCR2 interaction .

  • Expression level analysis - Monitoring PYCR2 expression at both mRNA (using RT-PCR) and protein levels (using western blotting) in cells transfected with E199L can demonstrate the functional consequence of the interaction .

  • Functional validation through co-transfection experiments - To establish causality, researchers should perform experiments with various combinations of plasmids (E199L overexpression, PYCR2 overexpression, PYCR2 knockdown) and measure the consequent autophagy markers .

What is the role of E199L in ASFV membrane fusion and viral entry?

E199L, along with another viral protein E248R, is implicated in ASFV membrane fusion and viral core penetration into the cytoplasm . These proteins are located in the inner membrane of the viral particle and are involved in crucial membrane processes during infection. Recent research indicates that E199L interacts with the late endosome integral membrane protein NPC1 (Niemann-Pick C1) . This interaction is particularly significant because it suggests that ASFV may penetrate to the cytoplasm from late endosomes in an NPC1-dependent manner, similar to mechanisms employed by certain other viruses. In the absence of E199L, ASFV infection efficiency dramatically decreases, with viral particles remaining trapped within late endosomes and lysosomes, demonstrating its crucial role in viral penetration .

How does E199L-induced autophagy impact ASFV replication and host cell survival?

The relationship between E199L-induced autophagy and ASFV replication represents a complex aspect of virus-host interaction. While E199L has been shown to induce autophagy through PYCR2 down-regulation , the precise impact of this autophagy activation on viral replication efficiency remains under investigation.

Autophagy can serve dual functions during viral infections: it may constitute a host defense mechanism to eliminate intracellular pathogens, or it could be subverted by viruses to support their replication by providing membrane components or metabolic resources. For ASFV, the E199L-induced autophagy might represent a viral strategy to create a favorable intracellular environment for replication. Alternatively, it could reflect a host response that the virus must subsequently counteract through other viral proteins.

Further research is needed to determine whether other ASFV proteins modulate the autophagic response during different stages of infection and how the temporal regulation of autophagy influences viral replication kinetics and cell survival.

What approaches can be used to study the structural determinants of E199L that are essential for PYCR2 interaction and autophagy induction?

To elucidate the critical structural elements of E199L involved in PYCR2 interaction and subsequent autophagy induction, researchers should employ a systematic structure-function analysis approach:

  • Domain mapping through deletion mutants - Creating a series of E199L truncation mutants to identify which regions are required for PYCR2 binding and autophagy induction.

  • Site-directed mutagenesis - Targeting conserved residues, particularly cysteines involved in disulfide bonds, to assess their contribution to protein function.

  • Structural modeling and molecular dynamics - Utilizing computational approaches to predict binding interfaces between E199L and PYCR2, generating hypotheses for experimental validation.

  • Cross-linking studies combined with mass spectrometry - Identifying specific amino acid residues involved in the protein-protein interaction.

  • Hydrogen/deuterium exchange mass spectrometry - Mapping conformational changes and binding interfaces with high resolution.

Each mutant or variant should be functionally characterized for PYCR2 binding (using CoIP), PYCR2 expression regulation (using RT-PCR and western blotting), and autophagy induction (measuring LC3-II/LC3-I ratio and P62 degradation) .

How can researchers distinguish between E199L-induced autophagy and other forms of autophagy activation in experimental settings?

Distinguishing E199L-induced autophagy from other autophagy activation pathways requires careful experimental design and appropriate controls:

  • Autophagy inhibitor studies - Using pharmacological inhibitors that target different stages of the autophagy pathway (e.g., 3-methyladenine for PI3K inhibition, bafilomycin A1 for blocking lysosomal degradation) to characterize the specific pathway activated by E199L.

  • siRNA knockdown of autophagy-related genes - Systematic knockdown of key autophagy regulators to identify which components are essential for E199L-induced autophagy.

  • Rescue experiments with PYCR2 - Since E199L induces autophagy through PYCR2 down-regulation, overexpression of PYCR2 should specifically reverse E199L-induced autophagy but not autophagy induced by other stimuli .

  • Temporal analysis - E199L-induced autophagy shows a specific time-dependent pattern, with LC3-II conversion beginning around 12 hours post-transfection and P62 degradation occurring later (24-36 hours) . This temporal signature can help distinguish it from other forms of autophagy.

  • Parallel comparison with known autophagy inducers - Side-by-side comparison with rapamycin (mTOR-dependent autophagy) or starvation-induced autophagy (amino acid sensing) can reveal pathway-specific differences.

What is the significance of the resemblance between E199L and poxviral fusion machinery subunits for vaccine development?

The structural similarity between E199L and three poxviral fusion machinery subunits (A16, G9, and A26) has important implications for vaccine development:

  • Cross-protective immunity potential - The structural resemblance might indicate the possibility of developing vaccines that could provide some level of cross-protection against both ASFV and poxviruses, though this would require extensive testing.

  • Conserved functional domains - The shared structural features likely represent evolutionarily conserved domains critical for viral function, making them potentially stable targets for vaccine development.

  • Fusion inhibitor development - Understanding the structural basis of membrane fusion machinery could facilitate the design of antivirals that specifically target these conserved structures.

  • Attenuated vaccine strategies - Knowledge of E199L's role in viral entry and its interaction with host factors like NPC1 could guide the rational design of attenuated ASFV strains where these functions are modified but not eliminated, potentially providing protection without causing disease.

  • Subunit vaccine design - Recombinant E199L protein, potentially modified to enhance immunogenicity while maintaining key epitopes, could serve as a component of subunit vaccines targeting the viral fusion machinery .

How does the interaction between E199L, E248R, and host NPC1 protein contribute to viral entry mechanisms?

Recent research has revealed a complex interplay between viral proteins E199L, E248R, and the host endosomal protein NPC1 during ASFV entry . Both E199L and E248R, which are located in the inner membrane of the viral particle, interact with NPC1, a late endosome integral membrane protein. This interaction appears critical for viral penetration into the cytoplasm from late endosomes.

The mechanism parallels strategies employed by certain other viruses that utilize NPC1 for endosomal escape. E248R, a myristoylated protein resembling vaccinia virus L1R protein (part of the poxvirus fusion complex), works in conjunction with E199L in this process . While direct interaction between E199L and E248R has not been definitively demonstrated , their collaborative role in mediating viral fusion and core penetration suggests they function as components of a fusion complex.

Understanding this tripartite interaction (E199L-E248R-NPC1) opens new avenues for therapeutic intervention by potentially disrupting viral entry through targeted inhibition of these protein interactions.

What challenges exist in using recombinant E199L for vaccine development against African swine fever?

Developing effective vaccines using recombinant E199L protein faces several significant challenges:

  • Protein stability and conformation - Ensuring that recombinantly expressed E199L maintains its native conformation, including proper disulfide bond formation, is critical for generating protective immune responses.

  • Adjuvant selection - Identifying appropriate adjuvants that enhance immunogenicity without triggering adverse effects remains challenging, particularly for protein subunit vaccines.

  • Cross-protection against diverse ASFV strains - E199L sequence variation across ASFV isolates might limit the breadth of protection offered by a vaccine based on a single variant (such as Ken-142) .

  • Cellular versus humoral immunity - Determining whether E199L-based vaccines primarily elicit antibody responses or cellular immunity, and which is more protective against ASFV infection, requires careful immunological studies.

  • Stability in delivery systems - Ensuring recombinant E199L remains stable in vaccine formulations during storage and delivery presents technical challenges that must be addressed for practical application.

  • Safety concerns with live attenuated approaches - When using E199L-modified ASFV strains in live attenuated vaccine approaches, ensuring complete attenuation without reversion to virulence requires extensive safety testing .

What are the most promising research directions for understanding E199L's role in ASFV pathogenesis?

Based on current knowledge, several research directions hold significant promise for advancing our understanding of E199L's role in ASFV pathogenesis:

  • Systems biology approaches - Comprehensive proteomics and transcriptomics studies to identify the full network of host factors influenced by E199L expression, beyond the known PYCR2 interaction.

  • In vivo models - Developing improved animal models to study how E199L-induced autophagy contributes to viral pathogenesis and immune evasion in the whole organism context.

  • Cryo-EM structural studies - Determining the three-dimensional structure of E199L alone and in complex with PYCR2 and/or NPC1 would provide crucial insights into its functional mechanisms.

  • Temporal regulation during infection - Investigating how E199L expression is regulated during the ASFV replication cycle and how its functions are coordinated with other viral proteins.

  • Comparative studies across ASFV strains - Analyzing E199L sequence and functional variations across virulent and attenuated ASFV strains could reveal correlations with pathogenicity.

  • Targeted gene editing approaches - Using CRISPR-Cas9 to generate specific mutations in E199L within the viral genome would allow precise dissection of its functions during authentic viral infection.

  • Cell-type specific effects - Examining how E199L functions differently in various relevant cell types, including porcine macrophages (the natural host cells) versus established laboratory cell lines.

What are the key experimental observations demonstrating E199L-induced autophagy?

Table 1: Timeline of Autophagy Markers After E199L Transfection in Vero Cells

Time Post-TransfectionLC3-II/LC3-I Ratio (Fold Change vs. Control)P62/β-actin Ratio (Fold Change vs. Control)Significance
6 hoursNo significant changeNo significant changeNS
12 hoursIncreased (p < 0.05)No significant change*p < 0.05
24 hoursSignificantly increased (p < 0.01)Significantly decreased (p < 0.001)**p < 0.01, ***p < 0.001
36 hoursSignificantly increased (p < 0.001)Significantly decreased (p < 0.001)***p < 0.001

Data compiled based on densitometric analysis of western blots from multiple independent experiments as reported in source material .

Table 2: Comparison of ASFV Proteins and Their Ability to Induce Autophagy

ASFV ProteinLC3-II/LC3-I ConversionP62 DegradationAutophagy Induction
E199LYes (significant)YesComplete
E183LNoNoNone
F317LNoNoNone
MGF 505-4RNot determinedNot determinedNot determined
CP530RNoNoNone
B602LNoNoNone

Data based on transient transfection experiments in Vero cells as reported in source material .

How does E199L-PYCR2 interaction affect autophagy signaling pathways?

Table 3: Effects of E199L and PYCR2 Manipulation on Autophagy Markers

Experimental ConditionLC3-II/LC3-I RatioP62 LevelAutophagy Status
Control (Empty Vector)BaselineBaselineBasal
E199L overexpressionIncreasedDecreasedInduced
PYCR2 knockdown (siRNA)IncreasedDecreasedInduced
E199L + PYCR2 knockdownIncreasedDecreasedInduced (similar to either condition alone)
E199L + PYCR2 overexpressionDecreased to baselineRecovered to baselineInhibited (rescued)

Data synthesized from experimental results showing that PYCR2 overexpression can completely rescue the autophagy-inducing effects of E199L .

What are the comparative structural features of E199L and related viral fusion proteins?

Table 4: Comparison of E199L with Poxviral Fusion Machinery Components

Protein FeatureASFV E199LPoxvirus A16Poxvirus G9Poxvirus A26
Membrane TopologyType I transmembraneEntry-fusion complex componentEntry-fusion complex componentFusion regulatory protein
Disulfide BondsPresent (cysteine-rich)PresentPresentPresent
Location in VirionInner viral membraneViral membraneViral membraneAssociated with viral membrane
Interaction with Host ProteinsNPC1, PYCR2Various fusion regulatorsVarious fusion regulatorsVarious fusion regulators
Role in EntryViral core penetrationMembrane fusionMembrane fusionFusion regulation
Effect When AbsentViral particles trapped in endosomes/lysosomesFusion defectFusion defectAltered fusion regulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.