Recombinant African swine fever virus Cysteine-rich protein E199L (Pret-142)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Pret-142; Cysteine-rich protein E199L; pE199L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Target Names
Pret-142
Target Protein Sequence
MSCMPVSTKCNDIWVDFSCTGPSISELQKKEPKAWAAILRSHTNQQTAEDDTIIGSICDK QGLCSKDEYAYSQYCACVNSGTLWAECAFAPCNGNKNAYKTTEQRNILTNKQCPSGLTIC QNIAEYGGSGNISDLYQNFNCNSVINTFLINVMNHPFLTLILIILILIIIYRLMSSSGGK HNDDKLPPPSLIFSNLNNF
Uniprot No.

Target Background

Protein Families
Asfivirus E199L family
Subcellular Location
Virion. Host membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of ASFV protein E199L?

E199L is a cysteine-rich structural polypeptide localized to the inner viral envelope of African swine fever virus. Biochemical analyses have shown that it behaves as an integral transmembrane polypeptide with cytosolic intramolecular disulfide bonds. The protein shows structural homology to poxvirus proteins of the entry fusion complex (EFC), specifically proteins A16, G9, and J5 . It resembles three poxviral fusion machinery subunits named A16, G9, and A26 . This structural similarity to poxviral proteins suggests evolutionary conservation in fusion machinery components across large DNA viruses.

How does protein E199L contribute to ASFV infection cycle?

Protein E199L plays a critical role in the ASFV infectious cycle, specifically during the viral entry process. It is not required for virus assembly, egress, or initial virus-cell binding and endocytosis. Instead, E199L is essential for the membrane fusion event that leads to the penetration of the genome-containing viral core into the host cell cytoplasm . In the absence of E199L, viral particles are retained within late endosomes and lysosomes, unable to complete the fusion process required for core release . This makes E199L a crucial component for the early stages of viral infection, without which the virus cannot establish productive infection.

What happens when E199L is absent or non-functional in ASFV?

Studies using an inducible ASFV recombinant (vE199Li) have demonstrated that E199L protein is essential for virus replication. When E199L expression is suppressed:

  • Plaque formation is drastically reduced

  • Virus titers decrease by more than 2.0 log units at 48 hours post-infection

  • Viral particles are produced but are approximately 100-fold less infectious than parental viruses

  • Virions can bind to cell surfaces and undergo endocytosis

  • Membrane fusion and core release into the cytosol fail to occur

  • Viral particles accumulate within lysosome-like structures

These findings confirm that E199L is indispensable for productive ASFV infection, specifically for the membrane fusion step of viral entry.

How can researchers generate inducible E199L recombinant viruses for functional studies?

To investigate the role of protein E199L in viral growth, researchers can generate an inducible recombinant virus (vE199Li) in which the expression of the E199L gene is under the control of the Escherichia coli lac operator/repressor system. The methodology involves:

  • Modifying the ASFV genome by replacing the original E199L gene promoter with a late, IPTG (isopropyl-β-d-thiogalactopyranoside)-dependent promoter

  • Inserting the E. coli lacI repressor gene under the control of a constitutive promoter

  • Using this recombinant virus for infection studies in the presence or absence of IPTG inducer

  • Evaluating virus growth through plaque assays and one-step growth curve analyses

This conditional lethal mutant approach allows researchers to specifically study the function of E199L by comparing virus behavior under permissive (with IPTG) versus non-permissive (without IPTG) conditions.

What cell culture systems are appropriate for studying E199L function?

Several cell systems have been reported for studying ASFV and E199L function:

Cell TypeOriginCulture MediumApplications
Vero cellsAfrican green monkey kidneyDMEM with 5% FBS, 1% P/S, 1% GlutamaxVirus propagation, plaque assays, transfection studies
HEK293T cellsHuman embryonic kidneyDMEM with 10% FBS, 1% P/S, 1% GlutamaxProtein expression studies, interaction analyses
Swine alveolar macrophages (PAMs)Porcine alveolar lavageRPMI with 10% swine serum, 2mM L-glutamine, 50μM 2-mercaptoethanol, 20mM Hepes, 30μg/ml gentamycinPrimary target cells, virus infection studies
WSL cellsWild boar lung cell lineIscove's modified Dulbecco's medium with Ham's F-12 nutrient mix, 10% FBSASFV-permissive cell line, genome transfection studies

For studying E199L specifically, both Vero cells and porcine macrophages have been used successfully, with Vero cells being particularly useful for recombinant virus production and plaque assays .

What techniques can be used to study E199L interactions with host factors?

Several techniques have been employed to study E199L interactions with host factors:

  • Mass Spectrometry-Based Interactome Analysis: Using label-free quantification with MaxQuant software to identify cellular proteins that interact with E199L. This approach has revealed interactions between E199L and the cholesterol transporter protein NPC1 .

  • EGFP-Fusion Protein Expression: Creating EGFP-E199L fusion proteins for immunoprecipitation studies and subsequent identification of interacting partners .

  • Volcano Plot Analysis: Statistical analysis using Perseus software platform to identify statistically significant interactions, with p-value thresholds set at <0.05 for t-test analysis .

  • NPC1 Knockout Cell Studies: Using CRISPR-engineered NPC1 knockout Vero cells to assess the importance of NPC1 in E199L-mediated entry .

  • Immunofluorescence Microscopy: To track the localization of E199L and potential interacting partners during infection .

These methodologies collectively provide a comprehensive toolbox for investigating the role of E199L and its interactions with host factors during ASFV infection.

How does E199L interact with host cell cholesterol transporters NPC1 and NPC2?

Research has demonstrated that E199L interacts with the cholesterol transporter proteins NPC1 and NPC2. Key findings include:

  • A direct interaction has been observed between E199L and the cholesterol transporter protein NPC1 (Niemann-Pick C type 1) .

  • The binding occurs between E199L and the loop C of NPC1, at the same domain as the Ebola virus (EBOV) binding site .

  • CRISPR NPC1 knockout Vero cells (which were also resistant to EBOV) showed significantly reduced ASFV infection levels .

  • Reductions in ASFV infectivity and replication in NPC1 knockout cells were accompanied by smaller viral factories lacking the typical cohesive morphology between endosomes and viral proteins .

  • A compensatory effect was observed in NPC1 knockout cells, with elevated NPC2 levels, while silencing NPC2 in Vero cells with shRNA also reduced ASFV infection .

These findings suggest that both NPC1 and NPC2 play important roles in E199L-mediated ASFV entry, potentially through regulating cholesterol within endosomal compartments where fusion occurs.

What is the relationship between E199L and E248R in the fusion machinery of ASFV?

E199L and E248R appear to function together as critical components of the ASFV fusion machinery:

  • Both E199L and E248R are inner membrane viral proteins that interact with the late endosome integral membrane protein NPC1 .

  • Defects in either protein result in the same phenotype: failure in membrane fusion and core release, with viral particles accumulating in lysosome-like structures .

  • Defective viruses lacking E199L protein contain normal levels of E248R and vice versa, indicating that both proteins are independently incorporated into virions .

  • Each protein plays a pivotal, non-redundant role in membrane fusion, suggesting they may form part of a multi-component fusion complex .

  • Both proteins show similarities to proteins in the entry fusion complex (EFC) of poxviruses, with E248R being related to poxviral L1 and F9 proteins, while E199L resembles A16, G9, and J5 proteins .

The accumulated evidence suggests that ASFV entry relies on a fusion machinery comprising at least E248R and E199L that displays similarities to the unconventional fusion apparatus of poxviruses, representing a potential target for antiviral strategies.

How does the structural homology between E199L and poxvirus fusion proteins inform our understanding of ASFV entry?

The structural homology between E199L and poxvirus fusion proteins provides valuable insights into ASFV entry mechanisms:

  • E199L shows structural similarities to three poxviral fusion machinery subunits: A16, G9, and A26 .

  • Like the corresponding poxviral proteins, E199L localizes to the inner viral envelope and behaves as an integral transmembrane polypeptide with cytosolic intramolecular disulfide bonds .

  • The homology suggests evolutionary conservation of fusion mechanisms among nucleocytoplasmic large DNA viruses (NCLDVs) .

  • The shared characteristics indicate that ASFV uses an unconventional fusion apparatus similar to poxviruses, rather than the more common class I, II, or III viral fusion proteins .

  • This insight helps explain why ASFV entry is complex and requires multiple proteins working in concert to achieve membrane fusion.

Understanding these homologies may help in developing broad-spectrum antivirals that target conserved mechanisms across multiple virus families.

What transcriptomic approaches can be used to study E199L expression during ASFV infection?

Several advanced transcriptomic techniques can be employed to study E199L expression:

  • Single-Cell RNA Sequencing (scRNA-seq): This high-throughput method allows characterization of individual cells infected with ASFV, revealing transcriptomic changes between infected and uninfected cells. The 10× Genomics platform has been used to profile approximately 108,000 individual cells during ASFV infection .

  • Real-Time RT-PCR: Can be used to validate and quantify E199L expression kinetics at different time points post-infection .

  • Viral Gene Expression Analysis: By capturing viral 5′ and 3′ transcripts in infected macrophages, researchers can determine the expression patterns of E199L in relation to other viral genes and classify it within the viral gene expression cascade (early vs. late) .

  • Transcriptional Regulator Networks: Construction of these networks can help identify host factors that may regulate E199L expression during infection .

These approaches provide complementary information about E199L expression patterns and regulation during the course of ASFV infection.

How can synthetic genomics approaches be used to study E199L function?

Synthetic genomics approaches offer powerful tools for studying E199L function:

  • Synthetic Genome Assembly: Full-length viral genomes can be assembled from synthetic fragments, allowing for precise manipulation of the E199L gene .

  • CRISPR-Cas9 Editing of ASFV TAR Clones: This technique enables targeted modification of the E199L gene within ASFV genomic clones. The process involves:

    • Designing sgRNAs targeting unique sequences near E199L

    • In vitro transcription of sgRNAs

    • Digestion of ASFV TAR clone DNA with Cas9 nuclease

    • Introduction of desired modifications

  • Recombinant Virus Generation: After genomic modification, recombinant viruses can be reconstituted by:

    • Releasing the full-length synthetic genome from YCpBAC by I-SceI digestion

    • Ligating the genome to synthetic hairpin loop-forming oligonucleotides

    • Transfecting the hairpin loop-containing synthetic genome into permissive cells

    • Using helper viruses for initial replication

  • Reporter Gene Integration: Fluorescent proteins or other reporters can be integrated into the viral genome to track infection and protein expression in real-time .

These synthetic biology approaches provide unprecedented control over viral genetics, allowing precise dissection of E199L function.

What experimental design considerations are important when developing in vitro models to study E199L function?

When designing experiments to study E199L function, several important considerations should be addressed:

  • Cell Type Selection:

    • Primary porcine macrophages represent the natural host cells but have variability

    • Established cell lines like Vero offer consistency but may not fully recapitulate natural infection

    • Consider using both primary cells and cell lines for comprehensive analysis

  • Temporal Sampling Strategy:

    • Include multiple time points (early, middle, late infection) to capture the dynamic role of E199L

    • Sample at consistent times post-infection across experiments to ensure comparability

  • Controls and Validation:

    • Include appropriate controls (mock-infected, UV-inactivated virus, irrelevant protein expression)

    • Validate key findings with multiple complementary techniques (e.g., biochemical, microscopic, and genetic approaches)

  • Data Analysis Approach:

    • For -omics data, apply stringent statistical thresholds (e.g., p < 0.05) and appropriate normalization

    • Consider both univariate and multivariate analyses to capture complex interactions

  • Biosafety Considerations:

    • Experiments with ASFV must be performed in appropriate biocontainment facilities

    • Follow biosafety level requirements according to local regulations (e.g., biosafety level 4 standards according to German genetic engineering safety regulations)

A well-designed experimental approach incorporating these considerations will provide more reliable and reproducible insights into E199L function in ASFV infection.

How might understanding E199L function contribute to ASFV vaccine development?

Understanding E199L function has significant implications for ASFV vaccine development:

  • Attenuated Vaccine Candidates: Knowledge of E199L's essential role in viral entry could guide the development of attenuated vaccine strains with modified E199L that maintain immunogenicity while reducing virulence .

  • Subunit Vaccine Design: E199L could be included in subunit vaccine formulations, potentially in combination with other structural proteins like E248R, to induce neutralizing antibodies targeting the viral fusion machinery .

  • Vectored Vaccines: E199L could be expressed in viral vectors to induce immunity against this critical protein while avoiding the risks associated with live ASFV .

  • Rational Design Approach: Understanding the structure-function relationship of E199L and its interactions with host factors like NPC1 could inform rational vaccine design targeting key epitopes while preserving immunogenic properties .

  • Challenge Models: The inducible E199L recombinant viruses could serve as valuable tools for evaluating vaccine efficacy by providing controlled challenge models .

By targeting a protein essential for viral entry, these approaches may contribute to developing the much-needed effective vaccines against ASFV.

What potential antiviral strategies could target E199L protein or its interactions?

The critical role of E199L in ASFV entry makes it an attractive target for antiviral development:

  • Small Molecule Inhibitors: Compounds that bind to E199L or disrupt its interactions with E248R or NPC1 could potentially block viral entry. The specific binding sites between E199L and NPC1 loop C could be targeted .

  • Peptide-Based Inhibitors: Designed peptides mimicking the interaction domains between E199L and its binding partners could competitively inhibit these interactions and prevent viral fusion .

  • Host-Directed Therapeutics: Drugs that temporarily modulate NPC1/NPC2 function or endosomal cholesterol levels might inhibit ASFV fusion without directly targeting viral proteins, potentially offering a higher barrier to resistance .

  • Combination Approaches: Targeting both E199L and E248R simultaneously could increase antiviral efficacy and reduce the likelihood of resistance development .

  • Repurposing Existing NPC1-Targeting Drugs: Compounds already developed to target NPC1 for other purposes (like Ebola virus inhibition) could be evaluated for activity against ASFV entry .

The identification of E199L as a critical component of ASFV fusion machinery provides new opportunities for developing targeted antiviral strategies against this economically devastating disease.

What are the key experimental challenges in translating E199L research to field applications?

Translating E199L research to field applications faces several significant challenges:

  • In Vitro to In Vivo Translation:

    • Cell culture systems may not fully recapitulate the complexity of natural ASFV infection

    • Animal models are essential but resource-intensive and ethically challenging

    • Validating E199L-targeting approaches requires demonstration of in vivo efficacy

  • Genetic Diversity Considerations:

    • E199L sequence may vary across ASFV isolates and genotypes

    • Antivirals or vaccines must account for this diversity to ensure broad protection

    • Conservation analysis across numerous ASFV strains is needed

  • Delivery and Formulation Issues:

    • E199L-based subunit vaccines may require specific adjuvants for optimal immunogenicity

    • E199L-targeting antivirals must reach appropriate cellular compartments (endosomes)

    • Stability under field conditions presents additional challenges

  • Regulatory and Safety Hurdles:

    • Novel approaches require extensive safety testing

    • Regulatory approval pathways for veterinary biologics vary globally

    • Cost-benefit considerations are critical for implementation

  • Resistance Development:

    • Single-target approaches may lead to resistance through mutation

    • Combination strategies targeting multiple viral functions are preferable

    • Monitoring for emergence of resistant variants is essential

Addressing these challenges requires collaborative efforts between basic researchers, veterinary scientists, pharmaceutical developers, and regulatory authorities to translate E199L research findings into practical solutions for controlling ASFV.

What methodologies can be used to purify recombinant E199L protein for structural and functional studies?

Purification of recombinant E199L presents challenges due to its membrane-associated nature, but several approaches can be employed:

  • Expression Systems:

    • Bacterial expression (E. coli) with fusion tags (His, GST, MBP) for solubility enhancement

    • Insect cell expression (baculovirus) for improved folding and post-translational modifications

    • Mammalian expression systems for native-like processing

  • Solubilization Strategies:

    • Use of detergents (non-ionic like DDM or Triton X-100) to extract membrane-associated E199L

    • Lipid nanodiscs for maintaining protein in a native-like membrane environment

    • Optimized buffer conditions to maintain stability during purification

  • Purification Techniques:

    • Affinity chromatography using tag-based approaches (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography for final polishing and buffer exchange

    • Ion exchange chromatography for charge-based separation

  • Quality Control:

    • Western blotting to confirm identity and integrity

    • Mass spectrometry for precise characterization

    • Functional assays to verify activity after purification

  • Structural Analysis Preparation:

    • Sample concentration optimization for structural studies

    • Buffer screening for stability in conditions compatible with structural techniques

    • Removal of fusion tags if necessary for native structure analysis

These approaches provide a framework for obtaining purified E199L suitable for detailed structural and functional characterization.

How can researchers effectively analyze the membrane topology and post-translational modifications of E199L?

Understanding the membrane topology and post-translational modifications of E199L requires specialized techniques:

  • Membrane Topology Analysis:

    • Protease protection assays to determine cytoplasmic vs. luminal domains

    • Selective permeabilization with digitonin or similar agents

    • Fluorescence-based approaches with GFP fusion at different positions

    • Computational prediction combined with experimental validation

  • Disulfide Bond Mapping:

    • Mass spectrometry under non-reducing and reducing conditions

    • Targeted mutagenesis of cysteine residues

    • Accessibility to thiol-modifying reagents

    • Mobility shift assays under different redox conditions

  • Glycosylation Analysis:

    • Treatment with glycosidases (PNGase F, Endo H)

    • Lectin blotting for glycan detection

    • Mass spectrometry of glycopeptides

    • Site-directed mutagenesis of potential glycosylation sites

  • Other Post-Translational Modifications:

    • Phosphorylation detection using phospho-specific antibodies

    • Mass spectrometry with enrichment for modified peptides

    • Western blotting with modification-specific detection

    • Metabolic labeling to track modifications

  • Structural Integration:

    • Cross-linking mass spectrometry to map protein topology

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • Lipid interaction analysis through lipidomics approaches

These methodologies provide comprehensive insights into the complex structural features of E199L that may be critical for its function in ASFV entry.

What are the most promising future research directions for understanding E199L's role in ASFV pathogenesis?

Several promising research directions could advance our understanding of E199L's role in ASFV pathogenesis:

  • Structural Biology Approaches:

    • High-resolution structures of E199L alone and in complex with interacting partners

    • Cryo-electron microscopy of the complete ASFV fusion machinery

    • Structure-guided mutagenesis to identify functional domains

  • Systems Biology Integration:

    • Multi-omics approaches combining proteomics, transcriptomics, and lipidomics

    • Network analysis to position E199L within the context of viral-host interactions

    • Mathematical modeling of the fusion process

  • Comparative Virology:

    • Detailed comparison of fusion mechanisms across the NCLDV group

    • Evolutionary analysis of E199L across ASFV isolates and related viruses

    • Functional complementation studies between related viral fusion proteins

  • Single-Virus Tracking Studies:

    • Real-time visualization of viral entry using labeled virions

    • Correlative light and electron microscopy to track E199L during entry

    • Super-resolution microscopy of fusion events

  • Host Range Determinants:

    • Investigation of E199L's potential role in host tropism

    • Comparative studies across susceptible and resistant cell types

    • Engineering E199L variants to test host range alteration

These approaches would collectively provide a more comprehensive understanding of E199L's multifaceted roles in ASFV infection and could identify new targets for intervention.

How might synthetic biology approaches advance our understanding of E199L function?

Synthetic biology offers revolutionary approaches to study E199L function:

  • Minimal Viral Systems:

    • Creation of synthetic virus-like particles displaying only essential entry components

    • Reconstitution of minimal fusion machinery to determine sufficiency

    • Bottom-up assembly of fusion-competent systems

  • Domain Swapping and Protein Engineering:

    • Chimeric proteins combining domains from E199L and related viral fusion proteins

    • Rationally designed E199L variants with altered fusion properties

    • Introduction of artificial regulatory elements to control E199L function

  • Orthogonal Labeling Strategies:

    • Incorporation of non-canonical amino acids for site-specific labeling

    • Click chemistry approaches for visualization of E199L dynamics

    • FRET-based sensors to detect conformational changes during fusion

  • Genome-Wide Functional Screening:

    • CRISPR activation/inhibition libraries to identify host factors affecting E199L function

    • Synthetic genetic interaction mapping to position E199L in cellular pathways

    • Combinatorial mutagenesis to comprehensively map functional residues

  • Cell-Free Systems:

    • Reconstitution of membrane fusion events in cell-free systems

    • Synthetic membrane platforms to study E199L-mediated fusion

    • Micro-fluidic approaches to quantify fusion kinetics

These synthetic biology approaches would provide unprecedented control and precision in dissecting E199L function, potentially revealing new aspects of ASFV entry mechanisms.

What are best practices for designing experiments to compare wild-type and mutant E199L proteins?

Rigorous experimental design is crucial when comparing wild-type and mutant E199L proteins:

  • Mutation Strategy Planning:

    • Structure-guided mutation design based on predicted functional domains

    • Conservative vs. non-conservative substitutions to distinguish structural from functional effects

    • Alanine-scanning mutagenesis for systematic functional mapping

    • Creation of multiple mutants affecting different domains

  • Expression System Consistency:

    • Use identical expression systems and conditions for all variants

    • Verify expression levels through multiple methods (Western blot, qPCR)

    • Include appropriate tags that don't interfere with function

    • Validate proper localization of all variants

  • Functional Assay Selection:

    • Employ multiple complementary assays measuring different aspects of function

    • Include both biochemical (binding) and biological (fusion) assays

    • Develop quantitative assays with appropriate dynamic range

    • Include positive and negative controls in each experiment

  • Data Analysis Approach:

    • Use appropriate statistical tests based on data distribution

    • Perform dose-response studies rather than single-point measurements

    • Consider both magnitude and kinetics of observed effects

    • Account for potential indirect effects through proper controls

  • Replication Strategy:

    • Conduct independent biological replicates (different virus preparations)

    • Include technical replicates to assess method reliability

    • Validate key findings using alternative methodological approaches

    • Consider blind analysis to minimize bias

Following these best practices ensures that differences observed between wild-type and mutant E199L proteins can be reliably attributed to the specific mutations introduced.

What statistical approaches are most appropriate for analyzing E199L interaction data?

Analysis of E199L interaction data requires robust statistical approaches:

  • For Mass Spectrometry Interactome Studies:

    • Label-free quantification using MaxQuant software

    • False discovery rate (FDR) set to 0.01 with decoy database inclusion

    • t-test analysis with p-value threshold <0.05

    • Volcano plot visualization to highlight statistically significant interactions

    • PERSEUS software processing to differentiate background from specific interactions

  • For Binding/Affinity Studies:

    • Non-linear regression for determination of binding parameters (Kd, Bmax)

    • Scatchard or Hill plot analysis for cooperativity assessment

    • ANOVA with appropriate post-hoc tests for comparing multiple conditions

    • Bootstrap or jackknife resampling for robust parameter estimation

  • For Colocalization Studies:

    • Pearson's or Mander's correlation coefficients for quantifying colocalization

    • Costes randomization for statistical significance of colocalization

    • Object-based approaches for discrete structures

    • Mixed-model ANOVA for experiments with multiple cells and conditions

  • For High-Throughput Screening Data:

    • Robust Z-score calculation to account for plate effects

    • Multiple testing correction (Bonferroni, Benjamini-Hochberg)

    • Machine learning approaches for multiparametric data

    • Network analysis for contextualizing interaction partners

  • Data Visualization Approaches:

    • Heat maps for comparing multiple interactions across conditions

    • Network diagrams to represent the interaction landscape

    • Principal component analysis for multivariate data reduction

    • Hierarchical clustering to identify patterns in interaction profiles

These statistical approaches ensure rigorous and reproducible analysis of E199L interaction data, facilitating meaningful biological interpretation.

How can researchers effectively integrate structural, biochemical, and cellular data to build comprehensive models of E199L function?

Integrating diverse data types requires sophisticated approaches to build comprehensive models of E199L function:

  • Data Integration Frameworks:

    • Bayesian networks to combine probabilistic evidence from multiple sources

    • Knowledge graphs to represent relationships between entities and findings

    • Constraint-based modeling incorporating structural and functional data

    • Multi-scale modeling connecting molecular events to cellular outcomes

  • Structural-Functional Mapping:

    • Map functional data onto structural models to identify critical domains

    • Molecular dynamics simulations informed by experimental constraints

    • Structural visualization of interaction interfaces with validation from mutagenesis

    • Prediction and testing of allosteric networks within the protein

  • Temporal Integration Strategies:

    • Time-resolved studies to track E199L throughout the entry process

    • Kinetic modeling of the fusion process incorporating rate constants

    • Event sequence reconstruction from snapshot data

    • Correlation of structural changes with functional outcomes

  • Computational Analysis Tools:

    • Machine learning approaches to identify patterns across diverse datasets

    • Network analysis to position E199L within host-pathogen interaction networks

    • Simulation of fusion events incorporating multiple data types

    • Sensitivity analysis to identify key parameters affecting model predictions

  • Iterative Model Refinement:

    • Generate testable hypotheses from initial models

    • Design targeted experiments to address model uncertainties

    • Update models with new experimental data

    • Develop simplified models that capture essential features for communication

By systematically integrating diverse data types through these approaches, researchers can build comprehensive, predictive models of E199L function in ASFV entry that guide hypothesis generation and experimental design in a virtuous cycle.

What collaborative research networks and resources are available for E199L researchers?

E199L researchers can leverage several collaborative networks and resources:

  • Research Institutions and Centers:

    • Instituto Nacional de Investigación y Tecnología Agraria y Alimentaria (INIA-CSIC), Madrid, Spain

    • Friedrich-Loeffler-Institut, Germany

    • The Pirbright Institute, UK

    • Harbin Veterinary Research Institute, Chinese Academy of Agricultural Sciences

  • Funding Resources:

    • National Key R&D Program of China

    • Intramural Special Grants for African Swine Fever Research from the Chinese Academy of Sciences

    • National Natural Science Foundation of China

    • European Union Horizon programs

  • Biological Resources:

    • ASFV strain collections and characterized isolates

    • Recombinant viruses with reporter genes

    • Cell lines (Vero, HEK293T, WSL)

    • Primary porcine alveolar macrophages protocols

  • Technological Platforms:

    • High-throughput single-cell RNA-sequencing (scRNA-seq) facilities

    • Mass spectrometry proteomics platforms

    • Synthetic genomics capabilities

    • CRISPR-Cas9 genome editing resources

  • Bioinformatics Resources:

    • MaxQuant and PERSEUS software for proteomics analysis

    • Viral genome annotation databases

    • Structural prediction tools

    • Specialized analysis pipelines for viral-host interactions

These collaborative networks and resources provide invaluable support for researchers studying E199L, facilitating access to specialized expertise, technologies, and materials that accelerate discovery.

How can researchers effectively design multidisciplinary approaches to study E199L biology?

Effective multidisciplinary approaches to E199L biology require strategic planning:

  • Team Composition Strategy:

    • Balance expertise across structural biology, virology, cell biology, and bioinformatics

    • Include both experimental and computational scientists

    • Combine specialists in different methodologies (imaging, proteomics, genomics)

    • Integrate basic and translational researchers

  • Experimental Design Coordination:

    • Develop standardized protocols across laboratories for comparability

    • Design experiments with complementary readouts from different techniques

    • Create sample sharing plans that maximize information from limited materials

    • Establish common positive and negative controls

  • Data Management Approaches:

    • Implement FAIR (Findable, Accessible, Interoperable, Reusable) data principles

    • Create integrated databases for diverse data types

    • Develop common ontologies and metadata standards

    • Establish data visualization platforms accessible to all team members

  • Communication Structures:

    • Regular interdisciplinary meetings with flexible formats

    • Shared project management tools for tracking progress

    • Cross-training opportunities for team members

    • Joint preparation of publications and presentations

  • Translational Pathways:

    • Early engagement with stakeholders in vaccine and antiviral development

    • Consideration of regulatory requirements for potential applications

    • Parallel development of basic understanding and applied outcomes

    • Feedback loops between fundamental discoveries and practical applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.