Recombinant African swine fever virus Cysteine-rich protein E199L (War-140)

Shipped with Ice Packs
In Stock

Description

Introduction

African swine fever (ASF) is a highly contagious and lethal hemorrhagic disease affecting domestic pigs and wild boars, often resulting in mortality rates approaching 100% in infected domestic pigs . The African swine fever virus (ASFV) is a large, complex DNA virus that replicates in the cytoplasm of infected cells . Due to the devastating impact of ASF on the global pig industry, there is a critical need to understand the virus's mechanisms and develop effective vaccines and antiviral strategies .

Recombinant African swine fever virus Cysteine-rich protein E199L (War-140), also referred to as pE199L, is a viral protein that has garnered significant attention for its role in virus entry and its potential as a target for therapeutic intervention .

General Information and Characteristics

Recombinant ASFV Cysteine-rich protein E199L (War-140) is a cysteine-rich structural polypeptide. It shows similarities to proteins A16, G9, and J5 of the entry fusion complex (EFC) of poxviruses . Key characteristics include:

  • Alternative Names: Cysteine-rich protein E199L, pE199L .

  • Source: The E199L protein is derived from the African swine fever virus, specifically isolate Warthog/Namibia/Wart80/1980 . Recombinant versions of the protein are often produced in E. coli .

  • Uniprot ID: P0CA96 .

  • Molecular Weight: The protein sequence corresponds to a full-length protein of 200 amino acids .

  • Localization: pE199L localizes to the inner viral envelope and behaves as an integral transmembrane polypeptide with cytosolic intramolecular disulfide bonds .

Role in Viral Infection

The pE199L protein is crucial for the African swine fever virus during the early stages of infection. Research indicates that pE199L is essential for membrane fusion and core penetration during viral entry . Specifically, pE199L is required for the fusion event that allows the viral genome to penetrate the host cell .

Studies using ASFV recombinants have shown that while pE199L is not required for virus assembly, egress, virus-cell binding or endocytosis, it plays a vital role in the membrane fusion process . This indicates that ASFV entry relies on a fusion mechanism involving pE199L and pE248R, showing similarities to the fusion apparatus seen in poxviruses .

Research Findings

Several studies have focused on the functional characterization of pE199L and its potential as a target for antiviral strategies.

  • Inhibition of Type I Interferon (IFN) Production: The ASFV H240R protein (pH240R), a capsid protein, was found to inhibit type I IFN production. This suggests that suppressing host innate immune responses is linked to viral pathogenicity. Deletion of the H240R gene reduces viral pathogenicity by enhancing type I IFN production, which decreases ASFV replication .

  • Interaction with Host Proteins: ASFV protein CP204L interacts with the cellular homotypic fusion and protein sorting (HOPS) protein VPS39, which affects endolysosomal trafficking and promotes lysosome clustering. The interaction between CP204L and VPS39 modulates host membrane rearrangement during infection. Loss of VPS39 reduces the levels of virus proteins synthesized in the early phase of infection and delays ASFV replication .

Potential for Vaccine Development

The identification of ASFV genes related to virulence and pathogenicity is crucial for developing live attenuated vaccines . E199L is a potential target for the development of strategies that block the early stages of ASFV replication . Some studies have explored the use of virally vectored African swine fever antigens, including E183L and CP204L, to induce protective immunity in pigs .

Tables and Data

FeatureDescription
Protein NameCysteine-rich protein E199L (War-140)
Alternative NamepE199L
Virus IsolateWarthog/Namibia/Wart80/1980
OriginAfrican swine fever virus (ASFV)
FunctionMediates virus entry by facilitating membrane fusion and core penetration
SimilarityShows similarity to poxvirus proteins A16, G9, and J5
LocalizationInner viral envelope
Involvement in Virus AssemblyNot required for virus assembly or egress
Potential ApplicationsTarget for antiviral strategies, vaccine development

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a useful guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type in advance; we will prioritize development to meet your specific needs.
Synonyms
War-140; Cysteine-rich protein E199L; pE199L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Target Names
War-140
Target Protein Sequence
MSCMPVSTKCNDIWVDFSCTGPSISELQKKEPKAWAAIVRSRTNQQTAEDDNIIGSICDK QGLCSKDEYAYSQYCACVNSGTLWAECAFAPCNGNKNAYKTTEQRNILTNKQCPSGLTIC QNIAEYGGSGNISDLYQNFNCNSVINTFLINVMNHPFLTLILIILILIIIYRLMSSSSGG KHNDDKLPPPSLIFSNLNNF
Uniprot No.

Target Background

Protein Families
Asfivirus E199L family
Subcellular Location
Virion. Host membrane; Single-pass membrane protein. Note=Found in cytoplasmic viral factories during assembly.

Q&A

What is the structural composition of the E199L protein?

E199L is a cysteine-rich structural polypeptide that functions as an integral transmembrane protein located in the inner viral envelope of African swine fever virus. The protein contains intramolecular disulfide bonds on the cytosolic side and shares structural similarities with proteins A16, G9, and J5 of the entry fusion complex (EFC) in poxviruses . The cysteine-rich nature of E199L suggests a role in maintaining structural integrity through disulfide bond formation, which is crucial for proper protein function during viral entry processes.

What is the subcellular localization of E199L during different stages of viral infection?

During viral assembly, E199L becomes incorporated into the inner viral membrane, as confirmed through biochemical and immunomicroscopic approaches . When virions are purified and analyzed through Percoll density gradients, E199L consistently localizes with inner membrane components rather than with outer envelope or core proteins. This localization is critical for its function in membrane fusion events during viral entry. Experimentally, this localization can be verified using immunofluorescence microscopy with antibodies against E199L alongside markers for different viral structural layers.

How does E199L contribute to the viral fusion machinery during ASFV entry?

E199L operates as an essential component of ASFV's fusion machinery alongside protein pE248R. Experimental evidence using an inducible recombinant virus (vE199Li) demonstrates that viral particles lacking E199L (vE199Li-) are unable to initiate infection despite normal endocytosis . Specifically, E199L facilitates the fusion between the virus inner membrane and the limiting membrane of late endosomes, which is required for delivering the genome-containing core into the host cell cytoplasm. Without E199L, the proportion of naked viral cores in the cytoplasm is reduced by more than 12-fold in both Vero cells and swine macrophages, as quantified through immunofluorescence microscopy using antibodies against viral inner membrane protein p12 and core component p150 .

What experimental approaches can be used to distinguish between E199L's role in virus attachment versus membrane fusion?

To differentiate between E199L's roles in viral attachment and membrane fusion, researchers can employ multiple complementary techniques:

  • Binding assays with purified virions (vE199Li+ vs. vE199Li-) at 4°C to assess attachment capacity

  • Endocytosis tracking using fluorescently labeled virions with confocal microscopy

  • Fusion assays using labeled viral and endosomal membranes to detect mixing of lipids

  • Core penetration assays using immunofluorescence microscopy with antibodies against core proteins (p150) and membrane proteins (p12)

Research has demonstrated that E199L is specifically required for membrane fusion and core penetration, not for virus assembly, egress, binding to cells, or endocytosis . This methodological approach allows researchers to pinpoint the precise stage of viral entry that requires E199L function.

What are the most effective approaches for generating antibodies against E199L for experimental detection?

For generating high-specificity antibodies against E199L, recombinant protein expression in bacterial systems has proven effective. The methodology involves:

  • Cloning the E199L ORF into an expression vector (e.g., pRSETA)

  • Expressing the protein in Escherichia coli

  • Isolating inclusion bodies containing recombinant E199L

  • Separating proteins using 12% polyacrylamide gel electrophoresis

  • Excising the E199L band for immunization

This approach has successfully generated polyclonal antibodies in rats with high specificity for E199L detection in various applications including Western blotting, immunofluorescence, and immunoprecipitation . For optimal results, researchers should consider using the full-length protein rather than peptides to ensure detection of conformational epitopes.

How can conditional expression systems be utilized to study the function of essential viral proteins like E199L?

For essential viral proteins like E199L, conditional expression systems provide valuable tools for functional studies. A proven methodology involves:

  • Generating inducible recombinant viruses (e.g., vE199Li) by replacing the native gene promoter with an IPTG-dependent promoter

  • Inserting a repressor gene (e.g., lacI) under a constitutive promoter

  • Growing the virus under permissive conditions (with inducer) for stock preparation

  • Conducting comparative analyses under permissive and non-permissive conditions

This system allows researchers to:

  • Produce viral particles lacking E199L for functional studies

  • Perform one-step growth curve analyses to quantify the impact on viral replication

  • Compare plaque formation between wild-type and conditional mutants

  • Analyze the biochemical composition of defective particles

Using this approach, researchers have demonstrated that E199L is essential for ASFV replication, with virus titers reduced by more than 2.0 log units at 48 hours post-infection under non-permissive conditions .

What molecular mechanisms underlie E199L-induced autophagy in host cells?

E199L induces a complete autophagy process in host cells through its interaction with Pyrroline-5-carboxylate reductase 2 (PYCR2). The molecular mechanism involves:

  • Direct binding between E199L and PYCR2, confirmed through co-immunoprecipitation coupled with mass spectrometry (CoIP-MS)

  • E199L-mediated downregulation of PYCR2 expression levels

  • Reduction in PYCR2 activity, which normally converts glutamate to proline

  • Activation of autophagy signaling pathways in response to altered PYCR2 levels

This process has been validated in both Vero and HEK-293T cells, suggesting a conserved mechanism across different cell types . The autophagy induction can be monitored using standard markers like LC3-II conversion, p62 degradation, and autophagosome formation through fluorescence microscopy.

How can researchers distinguish between E199L-induced autophagy and other forms of autophagy in experimental settings?

To differentiate E199L-induced autophagy from other forms, researchers should implement a multi-faceted approach:

  • Genetic verification: Using E199L knockout/knockdown systems compared to wild-type infections

  • Molecular pathway analysis: Examining PYCR2 levels and activity in E199L-expressing versus control cells

  • Pharmacological intervention: Testing whether PYCR2 supplementation or proline addition can reverse E199L-induced autophagy

  • Temporal assessment: Monitoring the kinetics of autophagy induction in relation to E199L expression

  • Comparative analysis: Using other autophagy inducers (rapamycin, starvation) alongside E199L expression

Through these approaches, researchers can establish the specific characteristics of E199L-induced autophagy, distinguishing it from canonical autophagy pathways or autophagy induced by other viral proteins.

How might the dual functions of E199L inform new antiviral strategies against ASFV?

E199L's dual roles in viral entry and autophagy regulation present multiple intervention opportunities:

  • Entry inhibition strategies:

    • Developing peptide inhibitors targeting the fusion domain of E199L

    • Designing small molecules that disrupt E199L-mediated membrane fusion

    • Creating antibodies that neutralize E199L function during viral entry

  • Autophagy modulation approaches:

    • Targeting the E199L-PYCR2 interaction to prevent autophagy manipulation

    • Developing compounds that restore PYCR2 levels during infection

    • Exploiting E199L-induced autophagy to promote viral clearance

Since E199L is essential for virus replication, with conditional knockouts showing >99% reduction in viral titers , it represents a high-value target for antiviral development. Additionally, understanding how E199L modulates autophagy could reveal insights into viral evasion of host defenses and inform broader antiviral strategies.

What experimental systems would be most appropriate for evaluating potential inhibitors of E199L function?

For evaluating E199L inhibitors, a multi-tiered experimental approach is recommended:

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) to assess direct binding of compounds to E199L

    • Thermal shift assays to evaluate compound effects on E199L stability

  • Cellular infection models:

    • Vero cells and porcine macrophages for initial screening

    • Primary porcine alveolar macrophages for physiologically relevant testing

    • Conditional E199L mutant viruses (vE199Li) as controls

  • Functional assays:

    • Membrane fusion assays to directly measure inhibition of E199L's fusion activity

    • Immunofluorescence microscopy to quantify core penetration in the presence of inhibitors

    • Autophagy assessment through LC3-II conversion and autophagosome formation

  • Mechanistic validation:

    • Co-immunoprecipitation to verify disruption of E199L-PYCR2 interaction

    • Structural studies (X-ray crystallography or cryo-EM) to confirm binding modes

This comprehensive approach would enable researchers to identify and validate E199L inhibitors with potential for development as antiviral therapeutics.

How does E199L sequence variation correlate with ASFV genotype and virulence?

E199L sequence conservation and variation analysis across ASFV genotypes provides important insights into structure-function relationships. While specific data on E199L variation across all 24 p72 genotypes is not completely detailed in the provided references, recent detection of recombinant ASFV strains involving genotypes I and II in Vietnam raises important questions about E199L conservation.

Researchers should consider:

  • Performing comparative sequence analysis of E199L across genotypes I and II

  • Examining whether recombination events affect the E199L coding region

  • Assessing if E199L sequence variations correlate with changes in viral tropism, fusion efficiency, or autophagy induction

  • Investigating whether E199L polymorphisms contribute to immune evasion or altered virulence

Understanding these variations could help explain differences in virulence between ASFV strains and inform the development of broadly effective countermeasures.

What methodological approaches are most suitable for detecting recombination events involving the E199L gene region?

For detecting and characterizing recombination events affecting E199L, researchers should implement a comprehensive genomic analysis approach:

  • Whole genome sequencing:

    • Next-generation sequencing of multiple isolates from different geographical regions

    • Deep sequencing to identify minor variants within viral populations

  • Recombination detection algorithms:

    • RDP4 software suite implementing multiple detection methods

    • SimPlot and Bootscan analyses to visualize potential recombination breakpoints

    • Maximum likelihood phylogenetic analyses of sequence segments

  • Functional validation:

    • Generation of chimeric E199L proteins based on detected recombination patterns

    • Testing fusion activity and PYCR2 interaction of recombinant E199L variants

    • Assessing virulence and replication efficiency of reconstructed recombinants

  • Evolutionary analyses:

    • Selection pressure analysis (dN/dS ratios) on the E199L gene

    • Bayesian phylogenetic approaches to date recombination events

    • Population genetic analyses to assess the spread of recombinant variants

Given the recent detection of recombinant ASFV strains in Vietnam involving genotypes I and II , surveillance for E199L recombinants should be prioritized to understand potential impacts on viral entry mechanics and autophagy regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.