Recombinant African swine fever virus Cysteine-rich protein E199L (Ba71V-130)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Ba71V-130; E199L; Cysteine-rich protein E199L; pE199L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Target Names
Ba71V-130
Target Protein Sequence
MSCMPVSTKCNDIWVDFSCTGPSISELQKKEPKAWAAILRSHTNQQTAEDDNIIGSICDK QGLCSKDEYAYSQYCACVNSGTLWAECAFAPCNGNKNAYKTTEHRNILTNKQCPSGLTIC QNIAEYGGSGNISDLYQNFNCNSVINTFLINVMNHPFLTLILIILILIIIYRLMPSSGGK HNDDKLPPPSLIFSNLNNF
Uniprot No.

Target Background

Database Links

KEGG: vg:22220358

Protein Families
Asfivirus E199L family
Subcellular Location
Virion. Host membrane; Single-pass membrane protein.

Q&A

What is the structural composition of ASFV E199L protein?

E199L is a cysteine-rich structural polypeptide with similarity to proteins A16, G9, and J5 of the entry fusion complex (EFC) of poxviruses. Biochemical and immunomicroscopic approaches have demonstrated that E199L localizes to the inner viral envelope and behaves as an integral transmembrane polypeptide with cytosolic intramolecular disulfide bonds . The full-length protein consists of 199 amino acids and is encoded by the E199L gene in the ASFV genome (BA71V strain) . For experimental work, recombinant versions of the protein can be produced with His-tags to facilitate purification and detection .

What is the current understanding of E199L's role in viral replication?

E199L is essential for ASFV replication as demonstrated through studies with inducible recombinant viruses. When E199L expression is suppressed using an IPTG-dependent system (vE199Li), viral titers are reduced by more than 2.0 log units at 48 hours post-infection . Plaque formation assays confirm this phenotype, showing a drastic decrease in plaque formation in the absence of the protein. Importantly, E199L is not required for virus assembly and egress or for virus-cell binding and endocytosis but is specifically necessary for membrane fusion and core penetration during viral entry .

How does E199L contribute to ASFV entry into host cells?

Research indicates that E199L is required for the fusion event that leads to the penetration of the genome-containing core into the host cell. During ASFV infection, endocytosed viral particles must fuse their inner envelope with the limiting membrane of late endosomes to deliver "naked" cores to the cytosol. Immunofluorescence studies using antibodies against viral inner membrane protein p12 and core component p150 show that in the absence of E199L, the proportion of naked cores in the cytoplasm decreases by more than 12-fold, indicating severe impairment of core delivery .

How does E199L interact with other viral proteins to facilitate membrane fusion?

E199L appears to work in concert with another ASFV protein, pE248R, to form a fusion machinery that displays similarities to the unconventional fusion apparatus of poxviruses . Both proteins are inner membrane components required for core penetration. Additionally, ASFV encodes a possible redox system comprising pB119L (a sulfhydryl oxidase) and pA151R (a protein with a CXXC redox motif), which may account for disulfide bonding in viral proteins including E199L . This redox machinery may be critical for establishing the correct disulfide bonding pattern in E199L that is necessary for its fusion activity.

What is the relationship between E199L and cellular autophagy pathways?

Recent research has revealed that E199L induces a complete autophagy process in Vero and HEK-293T cells . Through co-immunoprecipitation coupled with mass spectrometry (CoIP-MS) analysis, E199L was found to interact with Pyrroline-5-carboxylate reductase 2 (PYCR2), an enzyme primarily involved in the conversion of glutamate to proline . E199L down-regulates the expression of PYCR2, resulting in autophagy activation. This represents a novel function for E199L beyond its role in viral entry and suggests complex interactions between ASFV proteins and host cellular processes .

How does the molecular structure of E199L contribute to its function?

The cysteine-rich nature of E199L suggests that disulfide bonds play a critical role in its structure and function. The protein contains multiple cysteine residues that form intramolecular disulfide bonds in the cytosolic domains . These bonds likely maintain a specific three-dimensional conformation necessary for fusion activity. The transmembrane topology of E199L positions it correctly in the inner viral envelope, allowing it to participate in the fusion process when the viral and endosomal membranes come into proximity .

What genetic tools have been developed to study E199L function?

Researchers have created sophisticated genetic tools to study E199L function, including the vE199Li recombinant virus where E199L expression is controlled by the E. coli lac operator/repressor system . In this construct, the original E199L gene promoter is replaced by an IPTG-dependent promoter, and the E. coli lacI repressor gene is inserted under the control of a constitutive promoter. This allows for tight regulation of E199L expression depending on the presence or absence of IPTG in the culture medium . The design includes:

ComponentFunctionImplementation
Left flankContains E199L ORF2,080 bp (nucleotides 147582-149581)
Inducible cassetteControls expressionContains p72I* promoter, lacI repressor, β-glucuronidase reporter
Right flankContains downstream sequences2,035 bp (nucleotides 149404-151438)

This system enables researchers to study the conditional lethal phenotype associated with E199L deficiency and to evaluate its function at different stages of the viral life cycle .

What immunological tools are available for detecting and studying E199L?

Various antibodies have been developed for the detection and study of E199L and related ASFV proteins. For E199L specifically, antibodies have been generated by expressing the protein in E. coli, purifying inclusion bodies containing recombinant pE199L, and using these as immunogens to raise polyclonal antibodies in rats . Other antibodies against viral structural proteins (p150, p72, p12, p24) and cellular markers are available for co-localization studies. These include:

  • Rabbit polyclonal antibodies against ASFV polypeptides p150, p37, p34, p15, p35, p72, p49, p17, p12, pE248R, pEP402R/CD2v, p32, and pA104R

  • Mouse monoclonal antibodies against proteins p150 (clone 17A.H2), p72 (19B.A2), p12 (24BB7), and p24 (17E.H10)

  • Antibodies against cellular markers (α-tubulin, β-actin, GM130, CD63) for co-localization studies

What cell culture systems are optimal for studying E199L function?

E199L function has been successfully studied in multiple cell systems, each offering advantages for specific research questions:

  • Vero cells: African green monkey kidney cells commonly used for virus propagation and functional studies of E199L, including immunofluorescence assays to track viral entry events

  • Swine macrophages: Primary cells that represent natural host cells for ASFV infection, providing a physiologically relevant system for studying E199L function during viral entry

  • HEK-293T cells: Human embryonic kidney cells used to study E199L-induced autophagy and protein-protein interactions

When designing experiments, researchers should select the cell system most appropriate for their specific research question, considering factors such as transfection efficiency, susceptibility to ASFV infection, and availability of species-specific reagents.

How can understanding E199L function inform antiviral development strategies?

The essential role of E199L in viral entry makes it an attractive target for antiviral development. Interrupting the fusion process mediated by E199L could effectively block ASFV infection at an early stage . Research approaches might include:

  • High-throughput screening of small molecule inhibitors that bind to E199L and prevent its fusion activity

  • Development of peptide inhibitors that mimic interaction interfaces between E199L and other components of the fusion machinery

  • Structure-based drug design targeting critical domains or residues in E199L

  • Evaluation of compounds that disrupt E199L-PYCR2 interaction as potential antivirals with dual mechanisms of action

The essential nature of E199L for viral replication suggests that resistance mutations might come with fitness costs to the virus, potentially increasing the durability of E199L-targeted antivirals .

What experimental approaches are recommended for studying E199L-induced autophagy?

To investigate E199L-induced autophagy, researchers should consider a multi-faceted approach:

  • Visualization of autophagy markers: Monitor LC3 puncta formation and conversion of LC3-I to LC3-II using fluorescence microscopy and western blotting in cells expressing E199L

  • Flux assays: Use lysosomal inhibitors (e.g., chloroquine, bafilomycin A1) to distinguish between increased autophagosome formation and impaired degradation

  • Co-immunoprecipitation: Confirm E199L-PYCR2 interaction using reciprocal pulldowns with tagged proteins

  • Expression analysis: Quantify PYCR2 levels in the presence and absence of E199L using western blotting and qPCR

  • Functional validation: Use PYCR2 knockdown or overexpression to confirm its role in mediating E199L-induced autophagy

  • Metabolic analysis: Measure proline and glutamate levels to assess functional consequences of PYCR2 downregulation

What are the challenges in expressing and purifying recombinant E199L for structural studies?

Expressing and purifying functional E199L presents several challenges due to its nature as a transmembrane protein with multiple disulfide bonds. Researchers should consider:

  • Expression systems: E. coli systems may be suitable for producing E199L for antibody production , but eukaryotic systems (insect or mammalian cells) may be needed for functional studies requiring proper folding and post-translational modifications

  • Solubilization strategies: Appropriate detergents or lipid nanodisc approaches may be required to maintain E199L in a native-like membrane environment

  • Purification approach: His-tagged versions of the protein facilitate purification via immobilized metal affinity chromatography , with subsequent size exclusion chromatography to improve purity

  • Redox conditions: Careful control of redox conditions may be necessary to ensure proper formation of intramolecular disulfide bonds

  • Stability assessment: Monitoring protein stability using techniques such as differential scanning fluorimetry can help optimize buffer conditions for downstream applications

What are the key unanswered questions regarding E199L structure and function?

Despite significant advances in understanding E199L, several important questions remain:

  • What is the three-dimensional structure of E199L, and how does it change during the fusion process?

  • What is the precise sequence of molecular events during E199L-mediated membrane fusion?

  • How do E199L and pE248R cooperate, and do they form a stable complex?

  • What is the stoichiometry of the fusion machinery components?

  • How does the viral redox system specifically target and modify E199L?

  • What is the evolutionary relationship between the ASFV fusion machinery and the poxvirus entry fusion complex?

  • What is the functional significance of E199L-induced autophagy for ASFV replication?

  • Are there host cell receptors or cofactors that interact with E199L during viral entry?

What novel methodologies might advance our understanding of E199L?

Emerging technologies could significantly enhance our understanding of E199L function:

  • Cryo-electron microscopy: To determine the structure of E199L alone or in complex with other viral proteins

  • Single-particle tracking: To visualize E199L dynamics during viral entry in real time

  • In vitro reconstitution systems: To study membrane fusion events with purified components

  • Proteomic approaches: To comprehensively identify host and viral interacting partners

  • CRISPR-Cas9 screening: To identify host factors required for E199L function

  • In situ structural techniques: Such as FRET-based sensors to monitor conformational changes during fusion

  • Computational modeling: To predict structural changes and design rational mutations for functional studies

  • Proximity labeling approaches: Such as BioID or APEX to identify transient or weak interactions in the cellular context

How might E199L research contribute to understanding broader viral fusion mechanisms?

Research on E199L has implications beyond ASFV biology:

  • The unusual fusion machinery of ASFV provides an alternative model to the well-studied class I, II, and III viral fusion proteins

  • Similarities between ASFV and poxvirus fusion systems suggest convergent evolution or ancient relationships between these viral families

  • The role of disulfide bonds in fusion protein function represents a common theme across diverse viruses

  • Understanding how large DNA viruses regulate host pathways like autophagy may reveal conserved virus-host interactions

  • Insights into membrane fusion mechanisms may have applications in drug delivery systems and cell-cell fusion technologies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.