Recombinant African swine fever virus Cysteine-rich protein E199L (Mal-138)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant African Swine Fever Virus Cysteine-Rich Protein E199L (Mal-138)

African swine fever virus (ASFV) is a large, complex DNA virus that causes a highly lethal hemorrhagic disease in domestic pigs and wild boars . The disease poses a significant threat to the global pig industry, especially in Eastern Europe, the Russian Federation, and Southeast Asia, where it is currently prevalent . A key area of research focuses on understanding the virus's mechanisms of infection to develop effective vaccines and antiviral strategies .

Recombinant African swine fever virus Cysteine-rich protein E199L (Mal-138), also referred to as pE199L, is a viral protein that plays a crucial role in the virus's entry into host cells . It is a cysteine-rich structural polypeptide, sharing similarities with the entry fusion complex (EFC) proteins A16, G9, and J5 of poxviruses .

Functional Role in Viral Entry

  • Virus Entry Mechanism: The pE199L protein is essential for the African swine fever virus to enter the host cell . Specifically, it is required for the fusion event that allows the viral genome-containing core to penetrate the host cell .

  • Fusion Machinery: Research suggests that ASFV entry depends on a fusion mechanism involving pE199L and another protein, pE248R . These proteins exhibit similarities to the unconventional fusion apparatus of poxviruses.

  • Independent of Assembly and Egress: Studies using ASFV recombinants that inducibly express the E199L gene have shown that pE199L is not required for virus assembly and egress . It is also not needed for virus-cell binding and endocytosis but is crucial for membrane fusion and core penetration .

Interaction with Host Cell Proteins

  • Endosomal Interactions: The E199L protein interacts with endosomal proteins such as Niemann-Pick C1 (NPC1), lysosomal-associated membrane protein 1 (Lamp1), and lysosomal-associated membrane protein 2 (Lamp2) . These interactions are crucial for viral membrane fusion and core penetration.

  • NPC1 Domain Specificity: The C domain of NPC1 is particularly important for its interaction with E199L, suggesting that this domain is essential for the viral protein's function during cell entry .

Implications for Vaccine and Antiviral Development

  • Target for Antiviral Strategies: The role of pE199L in viral entry makes it a potential target for developing antiviral strategies . Interfering with pE199L function could block the early stages of ASFV replication.

  • Live Attenuated Vaccines: Understanding the relationship between viral pathogenicity and immune evasion is vital for creating safe and effective ASF vaccines . Identifying and deleting genes related to virulence, such as H240R, is a key step in developing live attenuated vaccines.

Additional Functions and Interactions

  • Inflammasome Regulation: E199L has been reported as a positive regulator of the NLRP3- and AIM2- mediated inflammatory response . This function suggests that E199L is involved in modulating the host's immune response during ASFV infection.

  • Antigenic Properties: The protein is an important antigenic protein in immunoassays .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mal-138; j18L; Cysteine-rich protein E199L; pE199L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Target Names
Mal-138
Target Protein Sequence
MSCMPISTKCNDIWVDFSCTGPSLSELQKKEPKAWAAILRSQRSQQTAEDDTIIGSICDK QGLCSKNEYAYSQYCACVNSGTLWAECAFAPCNGNKNAYKTTEHRNILTNKQCPSGLTIC QNIAEYGGTGNISDLYQNFNCNSVINTFLINVMNHPFLTLILIILILVIIYRLMSSSGGK HNEDKLPPPSLIFSNLNNF
Uniprot No.

Target Background

Protein Families
Asfivirus E199L family
Subcellular Location
Virion. Host membrane; Single-pass membrane protein. Note=Found in cytoplasmic viral factories during assembly.

Q&A

What is the structural and functional characterization of E199L in ASFV?

E199L is a cysteine-rich structural polypeptide that shares approximately 8% amino acid identity with the L1R protein of vaccinia virus (VACV). The protein localizes specifically to the inner viral envelope of ASFV particles and functions as an integral transmembrane polypeptide with cytosolic intramolecular disulfide bonds. These structural characteristics are critical for its functionality in the viral life cycle, particularly during host cell entry. The protein's cysteine-rich nature suggests an important role in maintaining structural integrity through disulfide bond formation, which could be essential for proper protein folding and function during viral entry processes .

How does E199L compare functionally to related proteins in other viruses?

E199L demonstrates functional similarity to multiple proteins in the entry fusion complex (EFC) of poxviruses, specifically proteins A16, G9, and J5. This functional homology exists despite relatively low sequence identity (only 8% amino acid identity with VACV L1R). Both E199L and another ASFV protein, E248R, appear to play similar roles to L1R in vaccinia virus, suggesting evolutionary conservation of function despite sequence divergence. These functional similarities between ASFV and poxviral proteins indicate that ASFV likely employs a fusion machinery that shares some mechanistic properties with the unconventional fusion apparatus documented in poxviruses, despite being classified as a different viral family .

What experimental approaches have revealed E199L's role in viral entry?

Researchers have employed several sophisticated experimental approaches to elucidate E199L's function. A particularly effective method involved using an ASFV recombinant that inducibly expresses the E199L gene. This genetic approach allowed investigators to determine that while E199L is not required for virus assembly, egress, or initial virus-cell binding and endocytosis, it is absolutely essential for the critical processes of membrane fusion and core penetration. These findings were established through a combination of biochemical assays and immunomicroscopic approaches that enabled visualization of the protein's localization and functional activities during different stages of the viral infection cycle .

How does E199L interact with other viral proteins during the entry process?

Current research indicates that E199L likely functions in concert with another ASFV protein, E248R, as part of a viral fusion machinery that facilitates entry into host cells. E248R is an inner membrane virion component related to poxviral L1 and F9 EFC proteins. Similar experimental results regarding membrane fusion and core penetration have been reported for both E199L and E248R, strongly suggesting they may be functional partners in a larger fusion complex. The precise molecular interactions between these proteins and potential other components remain an active area of investigation, with implications for understanding the complete mechanism of ASFV entry into host cells .

What methodological approaches are most effective for studying E199L-mediated membrane fusion?

Studying E199L-mediated membrane fusion requires specialized methodologies that can detect and quantify fusion events. Based on published research, effective approaches include using recombinant viruses with inducible E199L expression systems, which allow researchers to control the timing and level of protein production. Additionally, biochemical fractionation techniques help determine the protein's subcellular localization, while immunomicroscopic approaches enable visualization of fusion events. For investigating the specific role of disulfide bonds in E199L function, site-directed mutagenesis of cysteine residues followed by functional assays provides valuable insights into structure-function relationships that may be critical for fusion activity .

What are the challenges in developing recombinant E199L for research applications?

Producing functional recombinant E199L presents several technical challenges for researchers. The protein's structural complexity, particularly its transmembrane nature and intramolecular disulfide bonds, makes expression in standard prokaryotic systems problematic. Maintaining proper protein folding and disulfide bond formation requires specialized expression systems. For viral vaccine applications, researchers must consider how modifications to E199L might affect viral replication and immunogenicity. Since E199L is essential for viral entry but not for virus assembly and egress, constructing deletion mutants requires complementing cell lines or inducible expression systems to propagate the virus initially before studying entry defects .

How is E199L being targeted in ASFV vaccine development strategies?

While E199L itself has not been specifically highlighted as a primary target in current ASFV vaccine development approaches, the protein represents a potentially valuable target for future strategies. Current ASFV vaccine approaches focus predominantly on the development of modified live vaccines (LAVs) through targeted gene deletion from different isolates. Various genes including P148R, A238L, A224L, A276R, and EP153R have been investigated as deletion targets for attenuated vaccine strains. Given E199L's essential role in viral entry, it represents a logical target that could be explored for developing entry-deficient viruses or subunit vaccines that elicit neutralizing antibodies against the fusion machinery. The ability to block the earliest stages of viral replication makes E199L an attractive candidate for intervention strategies .

How can researchers effectively compare sequence variations in E199L across ASFV isolates?

Comparative analysis of E199L sequences across different ASFV isolates requires robust bioinformatic approaches. Next-generation sequencing (NGS) data analysis has been successfully used to identify single nucleotide variations (SNVs) and insertions or deletions (indels) in various ASFV genes, including E199L. Researchers can map sequencing reads against reference ASFV genomes to detect mutations affecting open reading frames (ORFs). This approach has enabled the classification of ASFV variants into different lineages based on shared mutations. For comprehensive comparison of E199L sequences, researchers should employ multiple sequence alignment tools followed by phylogenetic analysis to establish evolutionary relationships and identify potentially functional mutations that might affect viral properties .

What methodological considerations are important when designing E199L expression systems?

When designing expression systems for E199L, researchers must consider several critical factors to ensure production of functional protein. Given E199L's transmembrane nature, expression systems that support proper membrane insertion and topology are essential. Mammalian or insect cell expression systems are generally preferred over bacterial systems. For structural and functional studies, maintaining the native disulfide bond patterns is crucial, requiring oxidizing environments during expression and purification. Tag placement requires careful consideration to avoid disrupting protein function, with C-terminal tags often preferred to minimize interference with signal sequences or membrane insertion. To assess functionality, researchers should incorporate assays that specifically measure fusion activity rather than simply protein expression levels .

What analytical techniques are most effective for characterizing recombinant E199L protein?

Characterization of recombinant E199L requires a multifaceted analytical approach. For structural analysis, techniques such as circular dichroism (CD) spectroscopy can assess secondary structure content, while thermal shift assays evaluate protein stability. Assessment of disulfide bond patterns may require mass spectrometry following partial reduction and alkylation. Functional characterization typically involves membrane fusion assays, which can be performed using fluorescent lipid mixing assays or content mixing experiments. Binding studies with potential cellular receptors can employ surface plasmon resonance (SPR) or bio-layer interferometry (BLI). For immunological characterization, enzyme-linked immunosorbent assays (ELISAs) using sera from infected or vaccinated animals can determine antibody recognition and potential neutralization capacity .

How can researchers differentiate between the functions of E199L and E248R in membrane fusion?

Distinguishing the specific contributions of E199L and E248R to membrane fusion requires sophisticated experimental approaches. Complementation studies using viruses with inducible expression of each protein can help determine whether they function sequentially or simultaneously. Protein-protein interaction studies, including co-immunoprecipitation or proximity ligation assays, can reveal direct physical interactions between these proteins. Domain swapping experiments, where portions of each protein are exchanged, may identify critical functional regions. Site-directed mutagenesis of conserved residues in each protein followed by fusion assays can pinpoint specific amino acids essential for function. Additionally, temporal expression studies during infection can establish whether these proteins function at the same or different stages of the entry process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.