Recombinant African swine fever virus Envelope protein p54 (Pret-138)

What is the structural and functional significance of ASFV p54 protein?

The p54 protein (encoded by the E183L gene) is a highly conserved structural envelope protein of the African swine fever virus. It has significant importance in virus assembly, particularly in the recruitment of viral membranes to virus factories. Research has demonstrated that p54 exhibits strong antigenicity, making it an ideal target for diagnostic assay development. The protein contains conserved antigenic sites that allow for broad detection of antibodies produced against different ASFV isolates worldwide . Additionally, p54 plays a critical role in virus-host interactions and has been implicated in modulating host immune responses.

What expression systems can be used for recombinant ASFV p54 production?

Both prokaryotic and eukaryotic expression systems can be effectively utilized for the recombinant production of ASFV p54 protein:

Prokaryotic Expression:

• The p54 gene can be cloned into expression vectors such as pET-52b(+)3C/LIC and transformed into E. coli competent cells like DH5α for plasmid amplification .

• For protein expression, the recombinant plasmid is typically transformed into BL21(DE3) cells and cultured to an appropriate optical density (OD600 value of approximately 0.6) .

• Protein expression is induced using IPTG at a final concentration of 1 mM .

• The expressed protein can be purified using affinity chromatography methods such as Ni-NTA Fast Start Kit to obtain the purified recombinant protein .

Eukaryotic Expression:

• The p54 gene can be cloned into baculovirus transfer vectors like pFastBac and transformed into DH10Bac cells to generate recombinant bacmid .

• Sf9 insect cells can be transfected with the recombinant bacmid using liposome-mediated transfection to produce recombinant baculovirus (AcNPV-p54) .

• The protein is expressed in infected Sf9 cells and can be harvested after appropriate incubation periods (usually 72 hours post-infection) .

How can the antigenicity of recombinant p54 protein be verified?

Verification of recombinant p54 protein antigenicity can be accomplished through multiple complementary methods:

• Western Blot Analysis: After SDS-PAGE separation, the expressed protein is transferred to nitrocellulose membrane and probed with ASF-positive reference serum as the primary antibody and horseradish peroxidase-labeled secondary antibody (e.g., rabbit anti-pig IgG). The presence of a specific hybridization band at the expected molecular weight (~28 kDa) confirms the antigenicity of the expressed protein .

• Indirect ELISA: Recombinant p54 protein can be coated onto ELISA plates and tested against ASF-positive serum samples to verify its ability to capture specific antibodies.

• Competitive ELISA: The recombinant p54 protein can be used in a competitive ELISA format where it competes with viral antigens for binding to specific antibodies in test serum samples .

• Immunization Studies: The immunogenicity of purified recombinant p54 protein can be tested by immunizing laboratory animals (e.g., BALB/c mice) and measuring the resulting antibody response .

How can conserved antigenic sites within p54 be identified and characterized?

Identification and characterization of conserved antigenic sites within the p54 protein involves sophisticated methodological approaches:

• Sequence Alignment Analysis: Multiple sequence alignment of p54 sequences from different ASFV isolates can identify conserved regions that might serve as potential antigenic sites. Tools like MEGA, ClustalW, or MUSCLE can be employed for this purpose.

• Synthetic Peptide Approach: Synthesize overlapping peptides spanning the entire p54 sequence, with particular focus on conserved regions identified through alignment. These peptides can be screened against ASFV-positive sera to identify immunoreactive epitopes. For example, the synthetic amino acid polypeptide with the sequence 23SSRKKKAAAAIEEEDIQFINPYQDQQWAEV52 has been successfully used to screen for monoclonal antibody production .

• Monoclonal Antibody Generation and Epitope Mapping: Generate monoclonal antibodies against recombinant p54 protein by immunizing mice, followed by hybridoma technology. The specific epitopes recognized by these antibodies can be determined through techniques like peptide ELISA, peptide array analysis, or phage display .

• Structural Biology Approaches: X-ray crystallography or cryo-electron microscopy of p54 protein, especially in complex with neutralizing antibodies, can provide high-resolution structural information about antigenic sites.

• Mutagenesis Studies: Systematic site-directed mutagenesis of conserved regions can help identify critical residues involved in antibody binding.

What are the critical parameters for optimizing ELISA-based detection using recombinant p54?

Developing a robust ELISA system using recombinant p54 requires optimization of several critical parameters:

• Antigen Coating Concentration: Determine the optimal concentration of recombinant p54 protein for coating ELISA plates through checkerboard titration experiments. This typically ranges from 1-10 μg/ml depending on the purity and antigenicity of the preparation.

• Assay Format Selection: Evaluate different ELISA formats (indirect, competitive, sandwich) to determine which provides the best sensitivity and specificity for ASFV antibody detection. Competitive ELISA formats using monoclonal antibodies against conserved epitopes often provide improved specificity .

• Buffer Composition Optimization:

  • Coating buffer (carbonate/bicarbonate, pH 9.6)

  • Blocking buffer (typically 1-5% BSA or skim milk)

  • Sample diluent (PBS with 0.05% Tween-20 and appropriate protein concentration)

  • Washing buffer (PBS with 0.05-0.1% Tween-20)

• Incubation Conditions: Optimize temperature and duration for antigen coating, sample incubation, and detection antibody binding.

• Signal Detection System: Evaluate different enzyme-substrate combinations (HRP-TMB, AP-pNPP) for optimal signal-to-noise ratio.

• Cut-off Value Determination: Establish appropriate cut-off values using a panel of well-characterized positive and negative samples.

• Cross-Reactivity Assessment: Test for potential cross-reactivity with antibodies against related viruses to ensure specificity.

How does p54 contribute to potential vaccine development strategies against ASFV?

The p54 protein plays a significant role in vaccine development strategies against ASFV through several mechanisms:

• Subunit Vaccine Component: The p54 protein can be included as a component of subunit vaccines, often in combination with other ASFV antigens such as p30 and the virus soluble hemagglutinin (sHA) . These combinations have been shown to induce strong specific antibody responses, although they may not always provide complete protection against viral challenge .

• Enhanced Antigen Presentation Strategies: Fusion of p54 encoding genes with ubiquitin has shown improved protective efficacy compared to the unfused antigen, with some studies reporting 33% protection of immunized animals from ASFV challenge . This approach appears to enhance class I antigen presentation and strengthen CTL cell responses.

• Multi-Antigen Combinations: More effective protection has been achieved when p54 is combined with multiple ASFV antigens. For example, a combination of eight different antigens including p54 (B602L, B646L/p72, CP204L/p30, E183L/p54, E199L, EP153R, F317L, and MGF505-5R) delivered using recombinant adenovirus prime and MVA boost strategy has demonstrated protection against challenge with virulent genotype I ASFV strains .

• Prime-Boost Vaccination Strategies: Different delivery systems utilizing p54 as part of a prime-boost regimen have shown promising results. The use of recombinant adenovirus for priming followed by Modified Vaccinia Ankara (MVA) for boosting has been particularly effective .

• Adjuvant Optimization: Research into effective adjuvant formulations specifically designed to enhance immune responses to p54 and other ASFV antigens is crucial for improving subunit vaccine efficacy .

What are the key considerations for generating high-affinity monoclonal antibodies against p54?

Generating high-affinity monoclonal antibodies against p54 requires careful attention to several methodological aspects:

• Immunogen Preparation:

  • Use highly purified recombinant p54 protein expressed in either prokaryotic or eukaryotic systems.

  • Ensure proper protein folding to preserve conformational epitopes.

  • Consider using different forms of the antigen (full-length protein, specific domains, or synthetic peptides) to target different epitopes .

• Immunization Protocol:

  • Select appropriate animal species (typically BALB/c mice for hybridoma production) .

  • Develop an effective immunization schedule with primary immunization and multiple boosters.

  • Monitor antibody titers using ELISA to determine optimal timing for spleen harvest.

• Hybridoma Generation:

  • Fuse spleen cells from immunized mice with SP2/0 myeloma cells at an optimal ratio (10:1 is commonly used) .

  • Screen hybridoma supernatants against multiple forms of the antigen (prokaryotic and eukaryotic expressed p54 recombinant proteins, and synthetic peptides) to ensure broad recognition .

  • Employ limiting dilution for subcloning until positive rates reach 100% .

• Antibody Characterization:

  • Determine antibody isotype and subclass.

  • Assess specificity through Western blot and immunoprecipitation.

  • Measure affinity using surface plasmon resonance or bio-layer interferometry.

  • Evaluate cross-reactivity with p54 proteins from different ASFV genotypes.

  • Test functionality in various applications (ELISA, immunohistochemistry, neutralization assays).

• Production and Purification:

  • Scale up production through in vitro culture or in vivo ascites production.

  • Purify using protein A/G affinity chromatography.

  • Validate batch-to-batch consistency.

How can researchers troubleshoot inconsistent expression of recombinant p54 protein?

Troubleshooting inconsistent expression of recombinant p54 protein requires systematic investigation of multiple parameters:

• Sequence Verification:

  • Confirm the integrity of the p54 gene sequence in the expression construct.

  • Check for mutations, reading frame shifts, or unexpected stop codons.

• Prokaryotic Expression System Troubleshooting:

  • Optimize codon usage for E. coli if expression levels are low.

  • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express) for improved expression.

  • Adjust induction conditions: IPTG concentration (0.1-1.0 mM), induction temperature (16-37°C), and duration (4-24 hours).

  • Consider the addition of chaperones or fusion tags (MBP, SUMO, GST) to improve solubility.

  • For insoluble protein, optimize solubilization and refolding protocols.

• Baculovirus Expression System Troubleshooting:

  • Verify the quality and titer of recombinant baculovirus stocks.

  • Optimize multiplicity of infection (MOI) and harvest time.

  • Ensure the health and passage number of Sf9 cells.

  • Consider adding protease inhibitors during cell lysis.

• Protein Detection and Quantification:

  • Use multiple detection methods (Coomassie staining, Western blot with tag-specific antibodies, and ASFV-specific antibodies).

  • Optimize protein extraction conditions (buffer composition, lysis method).

  • Include positive controls in expression experiments.

• Purification Strategy Refinement:

  • Test different affinity tags and purification resins.

  • Optimize binding, washing, and elution conditions.

  • Consider secondary purification steps (ion exchange, size exclusion).

  • Evaluate protein stability in different storage buffers and conditions.

How can researchers address cross-reactivity issues in serological assays based on recombinant p54?

Cross-reactivity in p54-based serological assays presents a significant challenge that can be addressed through several sophisticated approaches:

• Epitope Mapping and Selection:

  • Identify unique, ASFV-specific epitopes within p54 through comprehensive epitope mapping.

  • Focus assay development on regions with minimal homology to proteins from other swine pathogens.

  • Use bioinformatics tools to predict potential cross-reactive epitopes based on sequence similarity with other viral proteins.

• Pre-adsorption Strategies:

  • Develop pre-adsorption protocols using antigens from potentially cross-reactive pathogens to remove non-specific antibodies from test samples.

  • Optimize serum dilution to minimize non-specific binding while maintaining sensitivity.

• Competitive Assay Formats:

  • Implement competitive ELISA designs using highly specific monoclonal antibodies against conserved ASFV-specific epitopes .

  • Optimize competitor concentrations and incubation conditions for maximum specificity.

• Advanced Statistical Analysis:

  • Apply receiver operating characteristic (ROC) curve analysis to establish optimal cut-off values that maximize specificity without compromising sensitivity.

  • Implement more sophisticated algorithms for result interpretation that account for background reactivity.

• Validation with Diverse Sample Panels:

  • Test assay performance using well-characterized serum panels from:

    • ASFV-infected animals (representing different virus genotypes)

    • Animals infected with potentially cross-reactive pathogens

    • Vaccination scenarios (if applicable)

    • Field samples from diverse geographical regions

• Multiplex Approaches:

  • Develop multiplex assays that simultaneously detect antibodies against multiple ASFV proteins (p54, p30, p72) to improve specificity through combinatorial analysis.

What are the best strategies for evaluating the efficacy of p54-based subunit vaccines?

Evaluating the efficacy of p54-based subunit vaccines requires comprehensive assessment protocols:

• Immune Response Characterization:

  • Measure both humoral and cell-mediated immune responses:

    • Antibody titers using various assay formats (ELISA, virus neutralization)

    • Isotype profiling (IgG1, IgG2, IgA)

    • T-cell responses (proliferation assays, cytokine production, ELISPOT)

    • Cytokine profiles (Th1 vs. Th2 balance)

  • Monitor kinetics of immune responses over time.

• Challenge Studies Design:

  • Challenge with homologous and heterologous ASFV strains to assess cross-protection.

  • Standardize challenge dose and route to ensure reproducibility.

  • Monitor comprehensive protection parameters:

    • Clinical signs scoring systems

    • Viremia levels (quantitative PCR)

    • Virus shedding in various secretions

    • Pathological lesions

    • Survival rates and times

• Prime-Boost Strategies Assessment:

  • Compare different delivery systems (DNA vaccines, viral vectors, protein-adjuvant formulations).

  • Evaluate various prime-boost combinations, including heterologous approaches.

  • Optimize intervals between prime and boost immunizations .

• Combination with Other ASFV Antigens:

  • Evaluate p54 in combination with other protective antigens (p30, p72, sHA).

  • Test different antigen ratios and formulations.

  • Assess the benefit of fusion proteins vs. antigen mixtures .

• Adjuvant Optimization:

  • Systematically compare different adjuvant formulations.

  • Evaluate novel adjuvant technologies designed to enhance specific immune pathways.

  • Assess safety profiles of different adjuvant-antigen combinations.

• Duration of Immunity Studies:

  • Conduct long-term studies (≥6 months) to assess duration of protective immunity.

  • Challenge vaccinated animals at different time points post-vaccination.

How can structural biology approaches advance our understanding of p54 function?

Structural biology approaches offer powerful tools for elucidating p54 function and informing rational protein engineering:

• Protein Structure Determination:

  • X-ray crystallography of purified p54 protein or specific domains.

  • Cryo-electron microscopy of p54 in the context of virions or virus-like particles.

  • NMR spectroscopy for dynamic regions or smaller domains.

  • Integration of experimental data with computational structure prediction (AlphaFold, RoseTTAFold).

• Structure-Function Analysis:

  • Map functional domains (membrane interaction, protein-protein interaction sites).

  • Identify conserved structural features across ASFV isolates.

  • Correlate structural elements with antigenic determinants.

  • Perform in silico docking studies with potential binding partners.

• Protein-Protein Interaction Studies:

  • Co-crystallization of p54 with binding partners or antibodies.

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces.

  • Surface plasmon resonance to quantify binding kinetics and affinities.

  • Cross-linking mass spectrometry to identify interaction sites.

• Rational Epitope Engineering:

  • Design stabilized forms of immunodominant epitopes.

  • Create chimeric proteins displaying multiple protective epitopes.

  • Develop structure-based immunogens with enhanced stability and immunogenicity.

• Molecular Dynamics Simulations:

  • Investigate conformational dynamics of p54 under different conditions.

  • Analyze the effect of mutations on protein stability and function.

  • Model interactions with membranes and other viral components.

• High-Resolution Imaging:

  • Super-resolution microscopy to visualize p54 distribution during infection.

  • Correlative light and electron microscopy to relate p54 localization to ultrastructural features.

  • Tomographic approaches to understand p54 organization in virions.