Recombinant African swine fever virus Envelope protein p54 (Mal-134)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can be used as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mal-134; j13L; Envelope protein p54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Target Names
Mal-134
Target Protein Sequence
MDSEFFQPVYPRHYGECLSSTPAPSFFSTHMYTILIAIVVLIIIIIVLIYLFSSRKKKAA AAIEEEDIQFINPYQDQQWAGVTPQPGIAKPAGASTGSAGKPVMGRPVTNKPVTNKPVTD RLGMAAGGPAAASAPAHPAELYTTATTQNTASQTMPADENLRQRNTYTHKDLENSL
Uniprot No.

Target Background

Function

This envelope protein is involved in intracellular microtubule-dependent transport of the viral capsid toward viral factories via interaction with host dynein. It appears to induce caspase-3 activation and apoptosis. Furthermore, it plays a crucial role in virion morphogenesis by recruiting and modifying host ER membranes into viral envelope precursors.

Protein Families
Asfivirus envelope protein p54 family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cytoplasm, host cytoskeleton. Host endoplasmic reticulum membrane.

Q&A

How does the p54 protein localize within infected cells and virus particles?

During ASFV infection, p54 displays dynamic subcellular localization that reflects its multifunctional role. Initially, p54 is targeted to the endoplasmic reticulum (ER) membranes, where it plays a critical role in recruiting and transforming these membranes into precursors of the viral envelope . This ER-targeting occurs both during infection and when p54 is expressed in transfected cells, indicating that the protein contains intrinsic ER-targeting signals .

As infection progresses, p54 becomes concentrated at viral factories, which are specialized cytoplasmic sites for viral replication and assembly. In mature virions, p54 is incorporated into both the envelope precursors and mature virus particles, where it is found in both intracellular and extracellular forms . This strategic localization reflects its essential roles in viral morphogenesis and subsequent infection cycles, particularly in virus attachment to susceptible cells .

What expression systems are optimal for producing functional recombinant p54?

Several expression systems have been utilized for p54 production, with recombinant technology allowing for controlled expression and purification:

  • Bacterial expression (E. coli): This system has been successfully employed for producing full-length p54 with an N-terminal His tag, as shown in the search results . E. coli expression typically yields high protein quantities that are suitable for structural studies, antigen preparation, or antibody production. The amino acid sequence (1-176) can be expressed with fusion tags like His to facilitate purification .

  • Mammalian expression systems: For functional studies requiring proper folding and post-translational modifications, mammalian expression systems may be preferred, although they typically yield lower protein amounts compared to bacterial systems.

When designing expression constructs, researchers should consider:

  • Inclusion of appropriate fusion tags (His, GST, MBP) based on downstream applications

  • Codon optimization for the chosen expression system

  • Signal peptide modifications if necessary for proper membrane targeting

  • Whether the transmembrane domain should be included or removed depending on the application

Experimental validation of proper folding and function is essential regardless of the chosen expression system, particularly for applications requiring biological activity.

What are the recommended purification and storage conditions for recombinant p54?

Based on commercial protocols and research practices, the following purification and storage recommendations can be made:

Purification protocol:

  • For His-tagged p54, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as the primary purification step

  • Proteins should be eluted with an imidazole gradient and thoroughly dialyzed to remove imidazole

  • Size exclusion chromatography can be used as a polishing step to separate monomeric and dimeric forms

  • The final product should achieve >90% purity as determined by SDS-PAGE

Storage conditions:

  • The purified protein is commonly supplied as a lyophilized powder for stability

  • For reconstitution, deionized sterile water is recommended to achieve a concentration of 0.1-1.0 mg/mL

  • For long-term storage, addition of 5-50% glycerol (typically 50%) and aliquoting for storage at -20°C/-80°C is advised

  • Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided

  • The optimal buffer system is Tris/PBS-based with 6% trehalose at pH 8.0

These conditions ensure stability while maintaining the protein's native conformation and functional properties for experimental applications.

How does p54 contribute to ASFV morphogenesis and envelope formation?

p54 plays a critical role in the early stages of ASFV morphogenesis through several mechanisms:

  • ER membrane recruitment: As a transmembrane protein, p54 is essential for the recruitment and transformation of endoplasmic reticulum membranes into the precursors of the viral envelope . This process is fundamental to the assembly of ASFV at cytoplasmic virus factories, where it initiates the formation of precursor membranous structures derived from ER cisternae .

  • Viral factory formation: Research using a conditional lethal recombinant virus (vE183Li) demonstrates that repression of p54 synthesis arrests virus morphogenesis at a very early stage, even before the formation of precursor membranes . Under restrictive conditions, virus factories appeared as discrete electron-lucent areas essentially free of viral structures, confirming p54's essential role in proper factory establishment .

  • Core assembly coordination: In the absence of p54, large amounts of aberrant zipper-like structures formed by unprocessed core polyproteins pp220 and pp62 are produced in association with ER cisternae . This indicates that p54 coordinates the proper spatial organization of core protein processing and assembly with envelope formation.

The multifunctional nature of p54 makes it indispensable for ASFV morphogenesis, as it serves as a critical link between viral envelope formation and core assembly processes.

What is the evidence for p54's role in virus attachment and entry?

Several lines of experimental evidence support p54's involvement in virus attachment and entry:

  • Binding studies: Purified p54 protein has been shown to prevent infection by blocking the attachment of virus particles to susceptible cells, suggesting direct involvement in receptor binding .

  • Antibody neutralization: Antibodies against p54 can prevent viral infection by interfering with the attachment process, further supporting its role in cellular recognition .

  • Deletion mutants: A p54-deleted recombinant virus (ASFV-G-ΔA104R) has been studied in animal models, showing reduced viremia compared to wild-type virus, indicating attenuation that may be partly attributed to altered attachment efficiency .

  • Protein interactions: p54 specifically interacts with the LC8 subunit of cytoplasmic dynein during viral infection, which may facilitate microtubule-mediated virus transport after entry . This interaction potentially enables efficient movement of internalized virus particles to replication sites.

These findings collectively position p54 as a multifunctional protein involved in both the initial virus-host cell interaction and subsequent intracellular transport processes, making it a potential target for antiviral strategies and vaccine development.

How does p54 interact with cellular components during ASFV infection?

p54 engages in several critical interactions with host cellular components that facilitate viral replication:

  • Dynein interaction: The most well-characterized interaction is with the LC8 subunit of cytoplasmic dynein, a minus-end-directed microtubule-associated motor protein . This interaction likely represents a mechanism for microtubule-mediated virus transport during infection, facilitating the movement of viral components to appropriate cellular locations .

  • ER membrane recruitment: p54's ability to localize to and modify ER membranes suggests interactions with resident ER proteins and lipid components, although specific molecular partners in this process remain to be fully characterized .

  • Viral factory formation: During the establishment of viral factories, p54 likely interacts with both viral and cellular factors to coordinate the spatial organization of these specialized replication and assembly sites .

The methodological approaches to study these interactions include co-immunoprecipitation, proximity ligation assays, and advanced imaging techniques such as super-resolution microscopy. Further proteomic studies are needed to identify the complete interactome of p54 during different stages of infection.

What role does p54 dimerization play in its function during viral infection?

p54 forms disulfide-linked homodimers through its unique luminal cysteine residue, a characteristic that has significant functional implications :

  • Structural stability: Dimerization likely enhances the stability of p54 within the viral envelope, creating a robust structural component that can withstand the stresses of virus assembly and release.

  • Functional domains: The dimeric configuration may create or expose functional domains necessary for interactions with other viral or cellular proteins. This could be particularly relevant for the protein's role in membrane recruitment and transformation.

  • Receptor binding: If p54 is involved in receptor recognition, as suggested by its role in virus attachment, dimerization could create a more effective binding interface through avidity effects or conformational changes.

  • Transport mechanism: The dimeric nature of p54 may facilitate its interaction with the dynein motor complex, potentially enhancing the efficiency of microtubule-mediated transport during infection.

Experimental approaches to study the functional significance of dimerization include site-directed mutagenesis of the cysteine residue involved in disulfide bond formation, followed by comparative functional assays with monomeric and dimeric forms of the protein.

What is known about the immunogenicity of p54 and its potential in ASFV diagnostics?

p54 has been identified as an immunogenic protein with significant potential for diagnostic applications:

  • Antibody responses: Infection with ASFV induces strong antibody responses against p54, making it a valuable target for serological diagnostics . Animals surviving infection with p54-mutant viruses develop strong virus-specific antibody responses, confirming its immunogenicity .

  • Conserved epitopes: The protein contains conserved epitopes across different ASFV isolates, making it suitable for developing broadly reactive diagnostic assays that can detect multiple virus strains.

  • Diagnostic applications:

    • ELISA assays using recombinant p54 can detect antibodies in infected animal sera

    • Multiplex assays combining p54 with other viral antigens (p30, p72) can improve diagnostic sensitivity and specificity

    • Lateral flow assays incorporating p54 epitopes could provide rapid field-based detection systems

For optimal diagnostic performance, recombinant p54 should be produced with proper folding to maintain conformational epitopes. The availability of high-purity recombinant p54, as described in the product specifications , facilitates the development and standardization of such diagnostic tools.

How does p54 contribute to vaccine development strategies against ASFV?

p54 represents a promising component for ASFV vaccine development through several approaches:

  • Subunit vaccines: As an immunogenic structural protein, p54 has been considered for inclusion in subunit vaccine formulations . Its involvement in virus attachment makes it a rational target for generating neutralizing antibodies that could block infection.

  • Attenuated vaccine platforms: Research with p54-deleted viral mutants has shown promising results. A recombinant virus with deletion in the p54 gene (ASFV-G-ΔA104R) demonstrated attenuated virulence while still inducing strong antibody responses, suggesting its potential as a live attenuated vaccine candidate .

  • Combination strategies: Optimal vaccine efficacy may require combining p54 with other immunogenic ASFV proteins (p30, p72, pp220, CD2v) to target multiple aspects of the virus life cycle and enhance protective immunity .

  • Delivery platforms:

    • Recombinant protein formulations with appropriate adjuvants

    • Viral vector-based delivery systems (adenovirus, MVA)

    • DNA vaccines encoding p54

    • Virus-like particles displaying p54 epitopes

The dual role of p54 in both structural integrity and virus attachment makes it a particularly valuable vaccine candidate, potentially eliciting antibodies that could neutralize the virus before cell entry and disrupt the viral life cycle.

What methodological approaches can determine the precise membrane topology of p54?

Understanding the exact membrane orientation and topology of p54 requires sophisticated methodological approaches:

  • Biochemical techniques:

    • Protease protection assays using microsomes containing p54 to determine which domains are accessible

    • Glycosylation mapping using artificial glycosylation sites introduced at various positions

    • Chemical labeling of accessible cysteine residues using membrane-impermeable reagents

  • Structural biology approaches:

    • Cryo-electron microscopy of p54 in membrane environments

    • NMR studies of isotopically labeled p54 in membrane-mimetic systems

    • X-ray crystallography of p54's soluble domains in complex with binding partners

  • Computational predictions and validation:

    • Molecular dynamics simulations of p54 in lipid bilayers

    • Topology prediction algorithms validated by experimental data

    • Integration of experimental constraints into refined structural models

The evidence suggests that p54 behaves as a type I membrane-anchored protein both in vitro and in infected cells , but detailed structural studies would provide valuable insights into how this orientation facilitates its multiple functions in viral morphogenesis and cell attachment.

How can p54 be exploited as a target for antiviral development?

p54's essential roles in multiple stages of the ASFV life cycle make it an attractive target for antiviral strategies:

  • Inhibition of virus attachment:

    • Small molecule inhibitors that bind to p54 and prevent its interaction with cellular receptors

    • Peptide-based inhibitors derived from receptor-binding domains

    • Monoclonal antibodies targeting critical epitopes involved in cell attachment

  • Disruption of protein-protein interactions:

    • Compounds that interfere with p54's interaction with the LC8 dynein subunit, potentially blocking intracellular transport

    • Molecules that prevent p54 dimerization, potentially destabilizing the protein's structure and function

    • Inhibitors of p54's interactions with other viral proteins essential for morphogenesis

  • Interference with membrane recruitment:

    • Compounds that block p54's ability to recruit and transform ER membranes

    • Molecules that alter the protein's membrane association properties

  • High-throughput screening approaches:

    • Cell-based assays monitoring p54 localization or function

    • In vitro binding assays to identify molecules disrupting specific interactions

    • Structure-based virtual screening using the p54 structure or models

The development of such antivirals would benefit from detailed structural information about p54 and its interactions, highlighting the interdependence of basic structural studies and applied therapeutic research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.