Recombinant African swine fever virus Major structural protein p17 (Pret-119)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Characteristics

The p17 protein is encoded by the ASFV D117L gene, comprising 117 amino acids with a molecular weight of ~17 kDa . Its recombinant form (Pret-119) retains the native structural features, including:

  • Three glycosylation sites: N12, N17, and N97

  • Transmembrane domain: Spanning residues A39–Y59

  • Trimeric configuration: Critical for stabilizing the viral capsid by anchoring p72 capsomers to the inner membrane

Recombinant p17 is typically expressed in E. coli systems with affinity tags (e.g., N-terminal His tag) for purification . Commercial suppliers like CUSABIO TECHNOLOGY LLC provide this protein for research applications .

Key Domains and Modifications

FeatureDetailsSource
Glycosylation SitesN12, N17, N97 – critical for protein-protein interactions
Transmembrane RegionA39-Y59 – essential for membrane localization and STING interaction
Capsid BindingForms trimers at p72 capsomer interfaces for structural stability

Deletion mutants (e.g., Δ39-59) lose membrane localization and immune-modulatory functions .

ER Stress and ROS-Mediated Cell Cycle Arrest

  • Induces G2/M phase arrest in host cells via endoplasmic reticulum (ER) stress .

  • Elevates intracellular reactive oxygen species (ROS), which exacerbate cell cycle dysregulation .

  • Pharmacological reduction of ROS partially restores cell proliferation .

Immune Evasion Mechanisms

  • Suppresses cGAS-STING signaling:

    • Co-localizes with STING via its transmembrane domain, inhibiting IFN-β promoter activation .

    • Reduces antiviral responses against HSV-1 and VSV by >50% in transfected cells .

  • Disrupts IRF3 phosphorylation: Recruits protein phosphatase PP2A to deactivate TBK1-IRF3 signaling .

Apoptosis Induction

  • Triggers caspase-dependent apoptosis in host cells, degrading STING and suppressing innate immunity .

  • Overexpression increases apoptotic markers (e.g., cleaved PARP) by 3–5-fold .

Implications for ASFV Pathogenesis

Recombinant p17 studies have revealed its dual role:

  1. Structural: Essential for icosahedral capsid assembly and virion maturation .

  2. Immunomodulatory: Targets multiple host pathways (ER stress, ROS, STING) to facilitate viral persistence .

Experimental knockdown of p17 reduces ASFV replication by 60–80% while upregulating IFN-γ and ISG15 .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, kindly indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. We recommend consulting your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its inclusion during production.
Synonyms
Pret-119; Major structural protein p17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Target Names
Pret-119
Target Protein Sequence
MDTETSPLLSHNLSTREGIKQSTQGLLAHTIAKYPGTTAILLGILILLVIILIIVAIVYY NRAVDCNSNMPKPPPSYYVQQPEPHHHFPVFFRRRKNSTSQQSHIPSDEQLAELAHS
Uniprot No.

Target Background

Function
Essential for the correct processing of both structural polyproteins and the maturation of viral precursor membranes at the viral factories.
Protein Families
Asfivirus major structural protein p17 family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of ASFV p17 protein?

The p17 protein is encoded by the ASFV D117L gene and comprises 117 amino acids with a molecular weight of approximately 17 kDa. It adopts a trimeric configuration that serves as a critical structural element for stabilizing the viral capsid by anchoring p72 capsomers to the inner membrane. The protein contains several key structural features:

FeatureDetailsFunction
Glycosylation SitesN12, N17, N97Critical for protein-protein interactions
Transmembrane RegionA39-Y59Essential for membrane localization and STING interaction
Capsid Binding DomainForms trimers at p72 capsomer interfacesProvides structural stability

The protein is localized at the viral internal envelope, and deletion mutants lacking the transmembrane region (Δ39-59) lose membrane localization and associated immune-modulatory functions.

How is recombinant p17 (Pret-119) typically expressed and purified for research applications?

Recombinant p17 (Pret-119) is typically expressed in E. coli expression systems using the following methodological approach:

  • Expression system selection: BL21(DE3) E. coli strains are commonly employed due to their high protein expression capabilities and reduced protease activity.

  • Vector construction: The D117L gene is cloned into prokaryotic expression vectors (pET or pGEX series) with affinity tags, most commonly an N-terminal His-tag for simplified purification.

  • Induction conditions: Expression is induced using IPTG (0.5-1.0 mM) at lower temperatures (16-25°C) to enhance proper folding and solubility.

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged proteins

    • Size exclusion chromatography for further purification and to confirm trimeric assembly

    • Buffer optimization containing 20-50 mM Tris-HCl (pH 8.0), 150-300 mM NaCl, and 5-10% glycerol for stability

  • Quality control: SDS-PAGE, Western blotting, and functional assays to verify identity, purity, and activity.

The recombinant protein should be stored in working aliquots at -80°C, as repeated freezing and thawing is not recommended for maintaining structural integrity.

What cellular localization patterns does p17 exhibit during infection versus in transfected cells?

P17 demonstrates specific subcellular localization patterns that are critical to its function:

During ASFV infection:

  • P17 localizes to viral precursor membranes and intracellular viral particles, confirming its role as a component of the inner viral envelope .

  • It accumulates within viral assembly sites, associated with viral precursor membranes derived from the endoplasmic reticulum (ER) .

  • Using electron microscopy, p17 has been identified as essential for viral morphogenesis at stages immediately after the formation of viral precursor membranes .

In transfected cells (outside viral infection):

  • When expressed independently in Vero cells (using a T7 RNA polymerase promoter system), p17 demonstrates an intrinsic affinity for the ER .

  • Confocal immunofluorescence analysis with double immunolabeling (anti-p17 antibody and anti-protein disulfide isomerase as an ER marker) shows p17 fluorescence signal colocalizing with ER-specific labeling .

  • This ER-targeting property appears to be intrinsic to p17 and likely relates to its role in recruiting and modifying ER-derived membranes for viral assembly .

The ability of p17 to target ER membranes even when expressed outside viral infection context indicates its fundamental role in the initial stages of viral morphogenesis.

How does p17 contribute to ASFV virion assembly and morphogenesis?

P17 plays an essential role in ASFV virion assembly through the following mechanisms:

  • Membrane recruitment and modification: P17 targets the ER membranes, which serve as the starting material for viral precursor membranes . This targeting ability is intrinsic to the protein, as demonstrated by its ER localization in transfected cells even outside the context of viral infection .

  • Progression of viral precursor membranes: Studies using an inducible virus for p17 reveal that this protein is required for the progression of viral precursor membranes toward icosahedral particles . When p17 expression is repressed:

    • Viral morphogenesis becomes blocked at an early stage

    • Precursor viral membranes accumulate but fail to progress

    • Major components of the capsid and core shell domains become delocalized

  • Polyprotein processing facilitation: P17 is essential for the proteolytic processing of viral polyproteins pp220 and pp62, which are precursors to several structural proteins . In the absence of p17, this processing is blocked, further disrupting virion assembly.

  • Formation of helicoidal intermediate structures: Analysis of ultrathin serial sections from infected cells revealed that p17 contributes to the formation of large helicoidal structures from which immature particles are produced . These structures represent a previously undetected viral intermediate in ASFV morphogenesis.

The absence of p17 results in complete blockage of viral production, confirming its status as an essential protein for ASFV viability .

What is the mechanism by which p17 disrupts host cell cycle progression?

P17 disrupts the host cell cycle through a multi-step mechanism primarily involving ER stress and reactive oxygen species (ROS), leading to G2/M phase arrest:

  • Induction of ER stress: P17 triggers endoplasmic reticulum stress when expressed in host cells . This was demonstrated in multiple cell lines including 293T, PK15, and PAM cells .

  • ROS elevation: Following ER stress, p17 significantly increases the levels of intracellular reactive oxygen species (ROS) . Flow cytometry analysis has shown that pre-treatment with 4-phenylbutyric acid (4-PBA, an ER stress inhibitor) decreases the production of ROS induced by p17 .

  • G2/M phase arrest mechanism:

    • The elevated ROS levels disrupt normal cell cycle checkpoints

    • This leads to accumulation of cells in the G2/M phase of the cell cycle

    • The arrested cell cycle provides optimal conditions for viral replication

  • Reversal experiments: Researchers have shown that decreasing ROS levels partially reverses the cell cycle arrest and prevents the decrease in cell proliferation induced by p17 . Similarly, alleviating ER stress decreases ROS production and prevents p17-induced inhibition of cell proliferation .

This interconnected pathway (p17 → ER stress → ROS elevation → G2/M arrest) appears to be a key mechanism by which ASFV manipulates the host cell environment to facilitate viral replication and persistence.

How does p17 protein inhibit the cGAS-STING pathway to facilitate immune evasion?

P17 employs a sophisticated mechanism to inhibit the cGAS-STING pathway, a key component of innate antiviral immunity:

  • Interference with signaling cascade activation: Dual-luciferase reporter assays in 293T cells have shown that p17 decreases cGAS/STING-stimulated activations of ISRE, IFN-β, and NF-κB promoters . Similar inhibitory effects were observed in p17-transfected primary alveolar macrophages (PAMs) stimulated with polydA:dT or 2'3'-cGAMP .

  • Disruption of protein-protein interactions: Co-immunoprecipitation (Co-IP) studies revealed that p17 inhibits:

    • The interaction between STING and TBK1

    • The interaction between STING and IKKε

  • Prevention of signalosome formation: Immunofluorescence assays (IFA) demonstrated that in the presence of p17, the co-localizations between STING and TBK1, and between STING and IKKε disappear . This prevents the formation of the signaling complex required for downstream activation.

  • Blocking of IRF3 phosphorylation: P17 disrupts IRF3 phosphorylation by recruiting protein phosphatase PP2A to deactivate TBK1-IRF3 signaling. This effectively blocks the transcription of interferons and interferon-stimulated genes.

  • Target specificity in the signaling pathway: Co-transfection experiments with p17 and various signaling molecules (STING, TBK1, IKKε, or IRF3-5D) showed that p17 inhibits signaling mediated by STING, TBK1, and IKKε, but not by constitutively active IRF3-5D . This indicates that p17 acts upstream of IRF3 activation.

The net effect of these mechanisms is substantial suppression of type I interferon responses, allowing the virus to evade innate immune detection and establish infection.

What experimental approaches can be used to evaluate p17's effects on innate immune signaling pathways?

Researchers can employ the following methodological approaches to study p17's immunomodulatory functions:

  • Reporter gene assays:

    • Dual-luciferase reporter assays using IFN-β, ISRE, and NF-κB promoter-driven luciferase constructs

    • Co-transfection of cGAS, STING, TBK1, IKKε, or IRF3-5D with p17 or vector control

    • Stimulation with DNA ligands (polydA:dT) or direct STING activators (2'3'-cGAMP)

    • Quantification of promoter activation by measuring luciferase activity

  • Protein interaction studies:

    • Co-immunoprecipitation (Co-IP) experiments with tagged versions of p17 and components of the cGAS-STING pathway

    • Immunofluorescence assays to visualize co-localization patterns

    • Proximity ligation assays to detect protein-protein interactions in situ

  • Downstream signaling analysis:

    • Western blot analysis of phosphorylated IRF3, TBK1, and IKKε levels

    • Subcellular fractionation to detect nuclear translocation of transcription factors

    • Chromatin immunoprecipitation (ChIP) assays to measure IRF3 binding to target gene promoters

  • Gene expression analysis:

    • RT-qPCR to measure mRNA levels of IFN-β, ISG15, ISG56, and IL-8

    • RNA-seq to profile global changes in gene expression

    • ELISA to quantify secreted cytokine and interferon levels

  • Structure-function relationship studies:

    • Expression of p17 deletion mutants (e.g., Δ39-59 lacking the transmembrane region)

    • Site-directed mutagenesis of key residues (glycosylation sites N12, N17, N97)

    • Domain-swapping experiments to identify critical regions for immune suppression

These approaches provide complementary data to comprehensively characterize p17's role in immune evasion and can help identify potential targets for therapeutic intervention.

How do deletion mutants of p17 affect its structural and immunomodulatory functions?

Deletion mutants of p17 have revealed critical structure-function relationships in both its structural and immunomodulatory roles:

  • Transmembrane region deletion (Δ39-59):

    • Structural impact: Loss of membrane localization, preventing proper incorporation into viral particles

    • Immunomodulatory effect: Significant reduction in ability to suppress cGAS-STING signaling due to impaired STING interaction

    • Viral assembly: Complete disruption of virion morphogenesis at an early stage

  • Glycosylation site mutations:

    • N12 mutation: Reduced protein stability and impaired trimer formation

    • N17 mutation: Diminished interaction with p72 capsomers, affecting capsid structure

    • N97 mutation: Altered immunomodulatory function with minimal impact on structural role

  • Experimental approaches for studying mutants:

    • Recombinant expression systems with site-directed mutagenesis

    • Trans-complementation assays in cells infected with p17-deficient viruses

    • Protein-protein interaction studies comparing wild-type and mutant p17

The dual impact of these mutations on both structural integrity and immune evasion underscores the multifunctional nature of p17 and suggests potential vulnerabilities that could be targeted for therapeutic intervention.

What is the role of reactive oxygen species (ROS) in p17-mediated cellular dysfunction?

Reactive oxygen species (ROS) serve as critical mediators in p17-induced cellular dysfunction through several interconnected mechanisms:

  • ROS generation pathway:

    • P17 expression first induces ER stress

    • ER stress subsequently triggers elevated production of intracellular ROS

    • Flow cytometry analysis confirms increased ROS levels in p17-expressing cells

  • Cell cycle dysregulation:

    • Elevated ROS levels directly contribute to G2/M phase arrest

    • This connection was demonstrated through ROS inhibition experiments

    • When ROS levels were pharmacologically reduced, cell proliferation was partially restored

  • Experimental evidence for causality:

    • Pre-treatment with 4-phenylbutyric acid (4-PBA), an ER stress inhibitor, significantly decreased ROS production induced by p17

    • Flow cytometry analysis quantitatively demonstrated this reduction

    • Alleviating ER stress therefore reduced ROS and prevented p17-induced cell proliferation inhibition

  • Potential molecular mechanisms:

    • ROS-mediated oxidation of cell cycle regulatory proteins

    • Activation of stress-responsive kinases (p38 MAPK, JNK)

    • DNA damage induction leading to checkpoint activation

    • Mitochondrial dysfunction resulting in apoptosis sensitization

This ROS-mediated pathway represents a key mechanism by which p17 creates a cellular environment conducive to viral replication while simultaneously contributing to host cell damage and ASF pathogenesis.

How can researchers optimize experimental conditions when working with recombinant p17 protein?

Optimizing experimental conditions for recombinant p17 research requires careful consideration of several key factors:

  • Protein storage and stability:

    • Store purified p17 at -80°C in small working aliquots

    • Avoid repeated freeze-thaw cycles which compromise structural integrity

    • Include stabilizing agents (5-10% glycerol) in storage buffers

    • Perform quality control tests before experimental use

  • Functional assay optimization:

    • For immunomodulatory studies: Use freshly isolated primary alveolar macrophages (PAMs) when possible, as they represent natural host cells

    • For structural studies: Ensure protein maintains trimeric configuration by including appropriate detergents and buffer conditions

    • For cell cycle analysis: Synchronize cells before p17 treatment to observe phase-specific effects more clearly

  • Cell type considerations:

    • Different cell types exhibit varying sensitivities to p17:

      • PAMs show strongest immune suppression responses

      • PK15 cells are optimal for studying cell cycle effects

      • 293T cells are suitable for high-efficiency transfection in reporter assays

  • Expression system selection:

    • Bacterial systems: Suitable for high-yield production but lack post-translational modifications

    • Mammalian systems: Better for full functional studies but with lower yield

    • Baculovirus systems: Good compromise for structural studies requiring glycosylation

  • Data interpretation guidelines:

    • Control experiments should include structurally similar ASFV proteins (e.g., p54) to distinguish p17-specific effects

    • Include dose-response analyses to establish physiologically relevant concentrations

    • Time-course experiments are essential for discriminating primary from secondary effects

By implementing these optimized conditions, researchers can enhance experimental reproducibility and generate more reliable data regarding p17's multifaceted functions.

How might understanding p17 function contribute to ASFV vaccine development strategies?

Understanding p17's structural and immunomodulatory functions offers several promising avenues for ASFV vaccine development:

  • Attenuated virus approaches:

    • Engineering p17 mutations that maintain structural functions but eliminate immune suppression capabilities could produce attenuated viruses with vaccine potential

    • Deletion mutants (e.g., modified Δ39-59 variants) that partially retain membrane localization but lose STING pathway inhibition would allow for controlled viral replication while permitting robust immune responses

  • Subunit vaccine design:

    • Structure-based design of p17 variants that maintain protective epitopes but lack immunosuppressive domains

    • Inclusion of p17 in multi-protein complexes that mimic viral structural assemblies for enhanced immunogenicity

    • Combining modified p17 with other ASFV structural proteins (p72, p54) for broad protective immunity

  • Adjuvant development:

    • Utilizing p17's known interaction with innate immune pathways to design targeted adjuvants

    • Developing STING agonists that can overcome p17-mediated suppression when co-administered with vaccine antigens

  • Experimental validation approaches:

    • In vitro assessment of immune activation using reporter systems in the presence of modified p17 proteins

    • Ex vivo studies with porcine alveolar macrophages to evaluate immune response profiles

    • In vivo protection studies measuring both antibody and cell-mediated immune responses

The essential nature of p17 for viral viability, as demonstrated by the complete blockage of viral production in its absence , highlights its potential as a key target for intervention strategies.

What experimental platforms are most suitable for high-throughput screening of inhibitors targeting p17 functions?

Researchers seeking to identify inhibitors of p17 function can employ several high-throughput screening (HTS) platforms:

  • Cell-based reporter systems:

    • Dual-luciferase assays: Cells co-transfected with p17 and STING pathway components linked to luciferase reporters

    • High-content imaging: Automated microscopy to track IRF3 nuclear translocation in p17-expressing cells

    • FRET-based assays: To detect disruption of p17-STING or STING-TBK1 interactions in real-time

  • Biochemical screening approaches:

    • AlphaScreen technology: For detecting compounds that disrupt p17-protein interactions

    • Surface plasmon resonance: To identify compounds that bind directly to p17 with high affinity

    • Thermal shift assays: To detect compounds that stabilize or destabilize p17 structure

  • Phenotypic screening platforms:

    • Cell cycle analysis: Flow cytometry-based screening for compounds that reverse p17-induced G2/M arrest

    • ROS detection assays: Identification of compounds that prevent p17-induced ROS elevation

    • ER stress reporter systems: To find inhibitors of p17-mediated ER stress induction

  • Viral replication models:

    • Inducible p17 viral systems: To evaluate compounds in the context of authentic viral morphogenesis

    • Mini-genome systems: For targeting p17's role in viral assembly without requiring full virus replication

    • High-content imaging of viral factory formation: To identify compounds disrupting p17's structural functions

  • Data analysis and validation pipeline:

    • Primary hits validated across multiple orthogonal assays

    • Structure-activity relationship studies for promising chemical scaffolds

    • Mechanistic validation using mutational analysis and resistance profiling

These platforms provide complementary approaches to identify compounds targeting different aspects of p17 function, potentially leading to novel therapeutic strategies against ASFV infection.

What are the most promising future research directions for understanding p17's role in ASFV pathogenesis?

Several high-priority research directions are poised to advance our understanding of p17's multifunctional role in ASFV pathogenesis:

  • Structural biology approaches:

    • High-resolution structural determination of p17 trimers using cryo-electron microscopy

    • Characterization of p17 in complex with host targets (STING, TBK1, IKKε)

    • Visualization of p17's incorporation into viral assembly intermediates and mature virions

  • Systems biology integration:

    • Comprehensive proteomics to identify all host factors interacting with p17

    • Phosphoproteomics to elucidate signaling pathways modulated by p17

    • Transcriptomics comparing wild-type and p17-deficient virus infections to map global effects

  • Advanced in vivo studies:

    • Development of transgenic porcine models expressing p17 to assess tissue-specific effects

    • Ex vivo organ culture systems to study p17's impact on tissue architecture

    • Single-cell approaches to characterize cell type-specific responses to p17

  • Novel therapeutic strategies:

    • Structure-guided design of p17 inhibitors targeting key functional domains

    • Development of synthetic biology approaches to neutralize p17's immunosuppressive functions

    • Exploration of host-directed therapies targeting cellular pathways exploited by p17

  • Evolutionary perspectives:

    • Comparative analysis of p17 homologs across ASFV isolates to identify conserved functional domains

    • Study of host adaptation signatures in p17 sequences from different geographical regions

    • Investigation of species-specific differences in p17-host protein interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.