Recombinant African swine fever virus Major structural protein p17 (Mal-115)

What is the basic structural characterization of ASFV p17 protein?

African swine fever virus p17 (Mal-115) is a major structural transmembrane protein localized in the capsid and inner lipid envelope of the virus. It consists of 117 amino acids with a sequence of MDTETSPLLSHNLSTREGIKQNTQGLLAHTIARHPGITAIILGILILLVIILIIVAIVYYNRSVDCKSNMPRPPPSYSIQQSEPHHHFPVFFRKRKNSTSQQAHIPSDEQLAELVHS. The protein appears to form trimers and is located at the interface of the center gap region of three neighboring pseudo-hexameric capsomers. Structurally, p17 contains a transmembrane domain (amino acids 39–59) that is critical for its function and protein-protein interactions . The protein is highly abundant in the viral structure and plays an essential role in the virus assembly and viability.

How does recombinant p17 protein differ from native viral p17?

Recombinant p17 protein produced in expression systems like E. coli typically contains additional tags (such as His-tag) fused to the N-terminus to facilitate purification and detection. While the core protein sequence remains identical to the native viral protein, these modifications may affect certain properties. The recombinant protein is often produced as a full-length protein (1-117 amino acids) and purified to greater than 90% purity as determined by SDS-PAGE . Unlike native p17, which exists in a lipid membrane environment within the virus, recombinant p17 is initially produced in a non-viral context and may require proper refolding to achieve its native conformation, particularly for the transmembrane regions. This difference should be considered when designing experiments using recombinant p17.

What are the recommended storage and handling conditions for recombinant p17 protein?

Recombinant p17 protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt. For long-term storage, it is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) and store in aliquots to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week. The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. Repeated freezing and thawing should be avoided as it may lead to protein denaturation and loss of activity. Prior to opening, it is advisable to briefly centrifuge the vial to bring contents to the bottom.

What is the specific role of p17 in ASFV structure and assembly?

Protein p17 plays a critical role in ASFV structure and assembly, particularly in the formation and maturation of the icosahedral capsid. Studies using inducible virus systems have demonstrated that p17 is essential for virus viability . During viral morphogenesis, p17 is required for the progression of viral precursor membranes toward icosahedral particles. It closely associates with the base domain of the major capsid protein p72, with three copies of p17 encircling each p72 trimer capsomer in the inner capsid shell, thereby firmly anchoring p72 capsomers on the inner membrane . When p17 expression is repressed, viral assembly is blocked at an early stage, immediately after the formation of viral precursor membranes, leading to an accumulation of these precursors and delocalization of viral components . Additionally, p17 repression blocks the proteolytic processing of viral polyproteins pp220 and pp62, which are essential for virion formation.

How does p17 contribute to ASFV immune evasion strategies?

ASFV p17 plays a significant role in viral immune evasion by inhibiting the host's cGAS-STING signaling pathway, which is critical for innate immune responses against DNA viruses. Research has shown that p17 exerts a negative regulatory effect on this pathway and on STING-dependent antiviral functions . Mechanistically, p17 localizes to the endoplasmic reticulum and Golgi apparatus where it directly interacts with STING (Stimulator of Interferon Genes). This interaction prevents STING from recruiting TBK1 and IKKε, thereby inhibiting downstream signaling that would normally lead to type I interferon production and an antiviral state .

When p17 is present, there is decreased activation of IFN-β, ISRE (Interferon-Stimulated Response Element), and NF-κB promoters following stimulation with DNA or cGAMP. Conversely, when p17 is suppressed using specific siRNA, ASFV-induced expression of IFN-β, ISG15, ISG56, IL-6, and IL-8 genes is upregulated in infected cells . This immune modulation function appears to be dependent on the transmembrane domain (amino acids 39–59) of p17, which is required for its interaction with STING.

How does p17 interact with host cellular components?

P17 primarily interacts with host cellular components through its association with the ER and Golgi apparatus, where it functions to modulate host immune responses. The protein has been shown to directly interact with STING, a key adaptor protein in the DNA sensing pathway . This interaction occurs through the transmembrane domain (amino acids 39–59) of p17 and interferes with STING's ability to recruit downstream signaling molecules TBK1 and IKKε, which are essential for activating IRF3 and NF-κB transcription factors.

Experimental evidence indicates that p17 can inhibit STING, TBK1, and IKKε-mediated activation of IFN-β, ISRE, and NF-κB promoters, but cannot inhibit the constitutively active IRF3-5D-mediated activation . This suggests that p17's inhibitory effect occurs at the level of STING-TBK1-IKKε interaction rather than downstream of IRF3 activation. The specific binding interface between p17 and STING has not been fully characterized, but it appears that p17's transmembrane domain is essential for this interaction and subsequent inhibition of the cGAS-STING pathway.

What are the validated methods for studying p17 function in vitro?

Several methodological approaches have been validated for studying p17 function in vitro:

• Inducible Virus Systems: Researchers have developed ASFV recombinants with inducible D117L gene (encoding p17) using the E. coli lac operator/repressor system. This allows controlled expression of p17 to study its function by comparing permissive versus restrictive conditions .

• Immunological Methods:

  • Immunoprecipitation using anti-p17 antisera and monoclonal antibodies

  • Immunoblotting for protein detection

  • Indirect immunofluorescence for cellular localization studies

• Promoter Activity Assays: Dual-luciferase reporter assays have been used to assess the effect of p17 on IFN-β, ISRE, and NF-κB promoter activities in response to cGAS-STING pathway stimulation .

• RNA Interference: siRNA targeting p17 has been employed to suppress its expression and study the subsequent effects on viral replication and host immune responses in primary porcine alveolar macrophages (PAMs) .

• Protein-Protein Interaction Studies: Co-immunoprecipitation experiments have been used to demonstrate p17's interaction with STING and its interference with TBK1 and IKKε recruitment .

• Antiviral Activity Assays: HSV1-GFP infection models have been utilized to assess the impact of p17 on STING-mediated antiviral responses, using fluorescence microscopy, flow cytometry, and virus titration methods .

What approaches can be used to express and purify recombinant p17 for structural studies?

For structural studies of recombinant p17, several expression and purification approaches can be employed:

Expression Systems:

• E. coli Expression: The most common approach involves expressing full-length p17 (1-117) with an N-terminal His-tag in E. coli . This system allows for high protein yield but may require optimization for proper folding of transmembrane proteins.

• Insect Cell Expression: Baculovirus expression systems may provide better folding for transmembrane proteins like p17.

• Mammalian Cell Expression: For studies requiring post-translational modifications and native folding, mammalian expression systems can be used.

Purification Protocol:

• Affinity Chromatography: Utilizing His-tag for IMAC (Immobilized Metal Affinity Chromatography)

• Size Exclusion Chromatography: To separate oligomeric forms and remove aggregates

• Ion Exchange Chromatography: For further purification based on charge properties

Considerations for Membrane Proteins:

• Use of detergents (e.g., DDM, LDAO) or amphipols to solubilize and stabilize the transmembrane regions

• Reconstitution into nanodiscs or liposomes for functional and structural studies

• Screening multiple constructs with varying lengths of the transmembrane domain

Quality Control:

• SDS-PAGE and Western blotting to confirm purity and identity

• Mass spectrometry for accurate molecular weight determination

• Circular dichroism to assess secondary structure

• Dynamic light scattering to evaluate homogeneity and oligomeric state

How can researchers design experiments to assess p17's immunomodulatory functions?

Researchers can employ the following experimental design strategies to assess p17's immunomodulatory functions:

Cell-Based Assays:

• Reporter Cell Lines: Establish cell lines (e.g., 293T cells, porcine cells) stably expressing luciferase reporters under IFN-β, ISRE, or NF-κB promoters. Transfect with p17 expression plasmids and stimulate with cGAS-STING pathway activators (polydA:dT, 2'3'-cGAMP) .

• Gene Expression Analysis: Transfect cells with p17 or control plasmids, stimulate the cGAS-STING pathway, and assess mRNA levels of IFN-β, ISGs (ISG15, ISG56), and inflammatory cytokines (IL-6, IL-8) using RT-qPCR.

Protein Interaction Studies:

• Co-Immunoprecipitation: Express tagged versions of p17 and STING in cells, immunoprecipitate one protein, and detect the interaction partner by Western blotting.

• Proximity Ligation Assay: Visualize protein-protein interactions between p17 and STING in situ within cells using antibody-based detection.

• Domain Mapping: Generate p17 mutants (particularly targeting the transmembrane domain amino acids 39-59) to identify regions essential for STING interaction and immunomodulatory function.

Signaling Pathway Analysis:

• Phosphorylation Assays: Assess the phosphorylation status of TBK1, IKKε, and IRF3 in the presence or absence of p17 following pathway stimulation.

• Recruitment Assays: Analyze the ability of STING to recruit TBK1 and IKKε in the presence of p17 using co-immunoprecipitation or confocal microscopy.

Viral Infection Models:

• Challenge Experiments: Transfect cells with p17 or control plasmids and challenge with DNA viruses (e.g., HSV1-GFP) to assess impact on viral replication .

• ASFV Infection with p17 Knockdown: Use siRNA to knockdown p17 in ASFV-infected primary porcine alveolar macrophages (PAMs) and measure changes in immune response genes and viral replication .

How can p17's role in ASFV pathogenesis be leveraged for vaccine development?

Understanding p17's role in ASFV pathogenesis offers several potential avenues for vaccine development:

Attenuated Virus Strategies:

• Conditional Expression Systems: Developing ASFV strains with controlled p17 expression could create attenuated viruses that induce immunity without causing disease. Since p17 is essential for viral assembly and immune evasion, viruses with regulated p17 expression might replicate sufficiently to induce immune responses but have limited pathogenicity .

• Function-Modified p17 Variants: Engineering ASFV with p17 mutations that maintain structural functions but eliminate immunomodulatory activities could generate viruses capable of replication while allowing robust immune detection and clearance.

Subunit Vaccine Approaches:

• Multi-Epitope Vaccines: Including B and T cell epitopes from p17 alongside other structural proteins in subunit vaccines could target multiple viral components simultaneously.

• Recombinant p17 as Antigen: Purified recombinant p17 protein or p17-expressing viral vectors could be used as immunogens, potentially triggering antibodies that interfere with virion assembly.

Immune Enhancement Strategies:

• Blocking p17-STING Interaction: Developing vaccines that elicit antibodies specifically targeting the p17 transmembrane domain (amino acids 39-59) could potentially block its immune evasion function, allowing stronger immune responses against ASFV infection .

• Adjuvant Selection: Choosing adjuvants that specifically boost cGAS-STING pathway activation could help overcome p17's immunosuppressive effects during vaccination.

Methodological Considerations:

• Animal Models: Testing vaccine candidates in appropriate swine models, considering that p17's effects may differ between domestic pigs and natural hosts (warthogs, bushpigs).

• Immunity Assessment: Evaluating both antibody responses against structural components and cell-mediated immunity targeting infected cells.

• Challenge Studies: Determining protection against different ASFV strains and doses to assess broad-spectrum immunity.

What is the relationship between p17 structure and its dual functions in viral assembly and immune evasion?

The relationship between p17 structure and its dual functions presents a fascinating research area with several key considerations:

Structural Domains and Function Mapping:
The 117-amino acid p17 protein contains distinct regions contributing to its different functions. The transmembrane domain (amino acids 39-59) has been identified as crucial for STING interaction and immune evasion , while other regions appear important for structural roles in the virion. Research suggests p17 forms trimers in the viral capsid, encircling p72 capsomers and anchoring them to the inner membrane . This structural arrangement is essential for capsid stability and virus viability.

Potential Structural Dichotomy:
Current evidence suggests p17 may have evolved overlapping but separable structural elements for its dual functions:

• Capsid Assembly Function: Likely involves regions that interact with p72 and other capsid proteins, forming the trimeric arrangement observed in virus particles.

• Immune Evasion Function: Centers around the transmembrane domain that interacts with STING and interferes with TBK1/IKKε recruitment.

Research Approaches to Explore This Relationship:

• Mutagenesis Studies: Systematic site-directed mutagenesis could identify which amino acids are critical for each function. Researchers could create and analyze p17 mutants with altered immune evasion capabilities but intact structural functions.

• Structure Determination: High-resolution structural studies of p17 alone, in complex with STING, and within the viral capsid would provide insights into potential conformational changes between these states.

• Functional Domain Swapping: Creating chimeric proteins with domains from related viral proteins could help identify which regions are sufficient for each function.

• Evolutionary Analysis: Comparing p17 sequences across ASFV isolates with different virulence profiles could reveal correlations between structural variations and functional differences.

Implications for Viral Evolution:
The dual functionality of p17 represents an efficient evolutionary strategy, where a single protein serves both structural and immune evasion roles. This economy of genome usage is particularly valuable for viruses with limited genetic material. Understanding this relationship could reveal insights into viral adaptation strategies and potentially identify vulnerabilities that could be targeted therapeutically.

What methodological challenges exist in studying transmembrane viral proteins like p17, and how can they be overcome?

Key Challenges and Solution Strategies:

Additional Technical Considerations:

• Purification Strategy Optimization:

  • Two-step purification combining affinity chromatography with size exclusion

  • Optimize buffer conditions (pH, salt, additives) for each purification step

  • Consider on-column detergent exchange during purification

• Protein Quality Assessment:

  • Circular dichroism to confirm secondary structure integrity

  • Thermal shift assays to assess protein stability

  • SEC-MALS to determine oligomeric state in solution

  • Native-PAGE to evaluate sample homogeneity

• Interaction Studies in Membrane Environment:

  • Microscale thermophoresis in the presence of nanodiscs or liposomes

  • Surface plasmon resonance with captured liposomes

  • Biolayer interferometry with immobilized membrane proteins

• Activity Validation Approaches:

  • Functional complementation assays in knockout systems

  • Proteoliposome reconstitution for membrane protein functional studies

  • Single-molecule techniques to study dynamic interactions

• In silico Integration:

  • Molecular dynamics simulations of membrane embedding

  • Coevolution analysis to predict interaction surfaces

  • Structure prediction tools optimized for membrane proteins

What are the unresolved questions regarding p17's mechanism of action in ASFV pathogenesis?

Despite significant advances in understanding p17's functions, several critical questions remain unresolved:

• Structural Determinants of Function:

  • How does the three-dimensional structure of p17 contribute to its dual role in viral assembly and immune evasion?

  • Which specific amino acid residues within the transmembrane domain (39-59) are critical for STING interaction?

  • What structural changes occur in p17 during virion assembly and maturation?

• Host-Pathogen Interaction Dynamics:

  • Does p17 interact with host factors beyond STING, TBK1, and IKKε?

  • How does p17's immune evasion function vary across different host species (domestic pigs vs. natural hosts)?

  • What is the kinetics of p17-mediated immune suppression during infection?

• Viral Assembly Mechanisms:

  • What is the precise molecular mechanism by which p17 facilitates the progression of viral precursor membranes to icosahedral particles?

  • How does p17 contribute to the proteolytic processing of polyproteins pp220 and pp62?

  • What other viral proteins directly interact with p17 during assembly?

• Evolutionary Considerations:

  • How conserved is p17 sequence and function across different ASFV isolates?

  • Has p17 evolved differently in viruses adapted to natural hosts versus those causing severe disease in domestic pigs?

  • Are there correlations between p17 sequence variations and ASFV virulence?

• Therapeutic Implications:

  • Can the essential nature of p17 be exploited for antiviral development?

  • Would blocking p17-STING interaction be sufficient to restore immune control of ASFV?

  • Could p17 be modified to create attenuated ASFV strains suitable for vaccine development?

How might cutting-edge technologies advance our understanding of p17 function and applications?

Emerging technologies offer promising avenues to address current knowledge gaps regarding p17:

• Advanced Structural Biology Approaches:

  • Cryo-Electron Tomography: Could reveal p17's arrangement within the viral particle in near-native conditions, providing insights into its structural role.

  • Integrative Structural Biology: Combining X-ray crystallography, NMR, and computational modeling to resolve the complete structure of p17 in different contexts.

  • Single-Particle Cryo-EM: May enable visualization of p17-STING complexes to understand interaction interfaces.

• Genome Editing and Synthetic Biology:

  • CRISPR-Cas9 Viral Engineering: Creating precise mutations in the p17 gene to study structure-function relationships.

  • Synthetic Viral Genomes: Building minimally replicating ASFV variants to identify essential p17 functions.

  • Domain Swapping: Creating chimeric viruses with modified p17 domains to map functional regions.

• Advanced Imaging Technologies:

  • Super-Resolution Microscopy: Tracking p17 localization and interactions during infection with nanometer precision.

  • Live-Cell Imaging: Monitoring p17 dynamics during viral assembly and immune evasion in real-time.

  • Correlative Light and Electron Microscopy (CLEM): Connecting p17 functional states with ultrastructural context.

• Systems Biology Approaches:

  • Proteomics Interaction Mapping: Comprehensive identification of p17 interaction partners throughout infection.

  • Phosphoproteomics: Characterizing signaling changes induced by p17 expression.

  • Transcriptomics: Analyzing global gene expression changes in response to p17 with and without immune stimulation.

• Computational and AI-Based Methods:

  • Machine Learning for Epitope Prediction: Identifying potential antigenic regions of p17 for vaccine design.

  • Molecular Dynamics Simulations: Modeling p17's behavior in membranes and during protein-protein interactions.

  • Network Analysis: Integrating multi-omics data to understand p17's position in virus-host interaction networks.

What are the most promising translational applications of p17 research for ASFV control?

Research on p17 offers several promising translational applications for ASFV control:

• Vaccine Development Strategies:

  • Attenuated Vaccine Candidates: Creating ASFV strains with modified p17 that maintain immunogenicity but have reduced pathogenicity .

  • Subunit Vaccines: Utilizing recombinant p17 as part of multi-component vaccines targeting multiple viral structural proteins.

  • Anti-Immune Evasion Vaccines: Developing immunogens that generate antibodies specifically blocking p17-STING interaction.

  • DNA or Vector Vaccines: Expressing modified p17 that cannot inhibit immune responses but can generate protective immunity.

• Diagnostic Applications:

  • Serological Tests: Developing p17-based ELISA or other immunoassays for detecting ASFV-specific antibodies.

  • Antigen Detection: Creating sensitive tests for p17 detection in clinical samples as a marker of ASFV infection.

  • Strain Differentiation: Utilizing p17 sequence variations to differentiate between ASFV strains or genotypes.

• Antiviral Development:

  • Capsid Assembly Inhibitors: Designing small molecules that interfere with p17's role in viral assembly.

  • Immune Evasion Blockers: Developing compounds that prevent p17-STING interaction, thereby restoring host immune detection.

  • Peptide Inhibitors: Creating peptides based on p17's interaction domains that competitively inhibit its functions.

• Biomarker Applications:

  • Disease Progression Indicators: Investigating whether anti-p17 antibody levels correlate with disease outcomes.

  • Protective Immunity Markers: Determining if specific immune responses against p17 epitopes predict protection.

  • Viral Fitness Assessment: Using p17 sequence analysis to predict virulence or transmission potential.

• Fundamental Virology Insights:

  • Viral Assembly Models: Applying knowledge of p17's role to understand related viruses and identify common mechanisms.

  • Immune Evasion Paradigms: Using p17 as a model system for understanding viral manipulation of cGAS-STING pathway.

  • Host Range Determination: Investigating whether p17 interactions with host factors contribute to ASFV species tropism.