Recombinant African swine fever virus Protein E248R (Pret-144)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence and Domains

E248R is a type II myristoylated transmembrane protein encoded by the ASFV E248R gene. Key features include:

  • Sequence length: 248 amino acids (aa 2–248) .

  • Myristoylation site: N-terminal motif for lipid anchoring .

  • Transmembrane domain: Hydrophobic region (aa ~220–240) critical for membrane integration .

  • Extracellular domain: 28 aa C-terminal region exposed outside the viral membrane .

  • Disulfide bonds: Intramolecular linkages formed via cysteine residues, stabilized by the ASFV-encoded redox system .

FeatureDetailsSource
MyristoylationN-terminal lipid anchor enhances membrane association
Transmembrane21 aa hydrophobic domain (aa 220–240)
Disulfide bondsCysteine residues form bonds analogous to VACV L1R fusion protein

Membrane Fusion and Endosomal Escape

E248R interacts with host endosomal proteins to facilitate viral core release:

  • NPC1 interaction: Binds the Niemann-Pick C1 (NPC1) cholesterol transporter’s C-domain via its transmembrane region .

  • NPC2 compensatory role: Knockout of NPC1 increases NPC2 levels, partially restoring infection, indicating redundancy in cholesterol-dependent processes .

  • Endosomal retention: In NPC1-KO cells, ASFV cores accumulate in enlarged endosomes, blocking cytoplasmic release .

Host ProteinInteraction DomainFunctional ImpactSource
NPC1C-domainCritical for membrane fusion and core release
NPC2Partial compensatory role in NPC1 absence

Viral Infectivity Defects

Deletion or absence of E248R drastically reduces ASFV infectivity:

  • 100-fold infectivity loss: E248R-deficient virions fail to induce cytopathic effects or gene expression post-entry .

  • No effect on binding/internalization: Defects occur post-entry, during endosomal escape or core penetration .

Comparative Analysis with Poxviruses

E248R shares functional homology with vaccinia virus (VACV) fusion proteins:

  • VACV L1R: 16.2% identity/30.7% similarity; both mediate membrane fusion via NPC1 interaction .

  • E199L: ASFV protein with homology to VACV A16/A26/G9 fusion subunits .

Recombinant Production and Applications

  1. Vaccine development: Served as a candidate antigen for ASFV subunit vaccines .

  2. Diagnostic tools: Used in immunoassays to detect anti-ASFV antibodies .

  3. Research models: Incorporated into recombinant viruses (e.g., PRRSV-E248R) to study replication dynamics .

PCR Detection Methods

A quantitative PCR method for E248R gene quantification:

Primer/ProbeSequence (5′→3′)PositionSource
E248R-FGGAGGCTCTACAAGCAAA166,996–167,013
E248R-RCATCACCGAATACGCCTA167,105–167,122
E248R-PFAM-AATACGACCAACATTATCAGCAAT-BHQ1167,025–167,050

Conditions:

  • Tm: 56–60°C

  • Ct values: 24.93–25.25 (plasmid standards) .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for preferential development.
Synonyms
Pret-144; Protein E248R; pE248R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-248
Protein Length
Full Length of Mature Protein
Species
African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Target Names
Pret-144
Target Protein Sequence
GGSTSKNSFKNTTNIISNSIFNQMQSCISMLDGKNYIGVFGDGNILNHVFQDLNLSLNTS CVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGTHDQKTDIEENIKVNLTTTLIQN CVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYT SKNFFDFIADAISAVFKNIMVAAVVIVLIIVGFIAVFYFLHSRHRHEEEEEAEPLISNKV LKNAAVS
Uniprot No.

Target Background

Function
Likely plays a role in an early post-entry event.
Protein Families
Asfivirus E248R family
Subcellular Location
Host membrane; Single-pass type II membrane protein. Virion.

Q&A

What is the structural characterization of ASFV protein E248R?

E248R is a structural protein located in the inner membrane of the African swine fever virus particle. The protein contains distinct domains including an external domain, a transmembrane (TM) domain, and an internal domain. The protein is myristoylated and membrane-associated . E248R shares structural similarity with several subunits of the poxvirus multiprotein entry/fusion complex, suggesting potential evolutionary relationships or functional parallels .

The protein contains a C-terminal putative transmembrane region (194SAVFK) and exhibits a characteristic N-terminal sequence (2GGSTSK7) that is consistent with myristoylation sites . This post-translational modification likely contributes to its membrane association properties and may be critical for its function in viral entry and membrane fusion processes.

How does E248R contribute to ASFV replication?

E248R plays a crucial role in ASFV replication, particularly during the early stages of infection. Studies using recombinant viruses with inducible E248R expression have demonstrated that in the absence of this protein, viral replication is significantly impaired . The protein appears to be involved in viral fusion events necessary for viral entry and potentially in the formation of viral replication sites.

The membrane association properties of E248R suggest it participates in membrane manipulation events that facilitate viral entry and the establishment of replication complexes. Its interaction with host endosomal proteins indicates a role in endosomal escape, allowing viral cores to access the cytoplasm where replication can proceed .

What experimental approaches have been used to study E248R function?

Several complementary experimental approaches have been employed to investigate E248R function:

  • Recombinant protein expression systems: Expression of E248R as a fusion protein (e.g., with EGFP or HA tags) in cell lines such as HEK 293T cells .

  • Inducible expression systems: Creation of recombinant viruses with inducible E248R expression to study the effects of E248R absence on viral replication .

  • Co-immunoprecipitation assays: Used to identify protein-protein interactions between E248R and host cellular factors such as NPC1 .

  • Domain deletion analysis: Construction of deletion mutants lacking specific protein domains to determine which regions are essential for function and protein-protein interactions .

  • Reverse pull-down experiments: Confirmation of protein-protein interactions through reciprocal co-immunoprecipitations using antibodies against different epitope tags .

How does E248R interact with endosomal proteins, particularly NPC1?

E248R has been demonstrated to interact with several endosomal proteins, most notably Niemann-Pick C1 (NPC1) and lysosomal-associated membrane protein 2 (Lamp2). These interactions have been confirmed through multiple experimental approaches, including co-immunoprecipitation studies .

The interaction between E248R and NPC1 appears to be mediated primarily through the transmembrane domain of E248R. Deletion mutants lacking the TM domain fail to interact with NPC1, while constructs containing this domain maintain the interaction . Specifically, E248R binds to the C domain of NPC1, as demonstrated through co-immunoprecipitation experiments with individual NPC1 domains .

The interaction data can be summarized in the following table:

Viral ProteinHost ProteinInteracting Domain of Viral ProteinInteracting Domain of Host ProteinDetection Method
E248RNPC1Transmembrane domainC domainCo-IP/Western Blot
E248RLamp2Not fully characterizedNot fully characterizedCo-IP/Western Blot
E199LNPC1Not fully characterizedC domainCo-IP/Western Blot
E199LLamp1Not fully characterizedNot fully characterizedCo-IP/Western Blot
E199LLamp2Not fully characterizedNot fully characterizedCo-IP/Western Blot

This interaction with endosomal proteins suggests that E248R plays a critical role in viral escape from endosomes during entry, allowing viral cores to access the cytoplasm for replication .

What is the functional significance of E248R's interaction with NPC1?

The interaction between E248R and NPC1 appears to be critical for the endosomal escape of ASFV during viral entry. Studies have shown that in the absence of NPC1, incoming viral cores are retained inside endosomes, preventing them from continuing the infection process .

This mechanism is reminiscent of other viruses that utilize endosomal proteins for entry. For example, Ebola virus also requires NPC1 for viral entry, although through different viral proteins. The conservation of this mechanism across different virus families suggests a convergent evolutionary strategy for endosomal escape.

The functional significance of this interaction makes it a potential target for antiviral development. Disrupting the E248R-NPC1 interaction could potentially inhibit viral entry and thus prevent infection. This approach would target a host-virus interaction rather than a viral component alone, potentially reducing the likelihood of viral resistance through mutation.

How do mutations or deletions in E248R domains affect its function?

Domain deletion studies have provided significant insights into the functional architecture of E248R. Several deletion mutants have been constructed to analyze domain-specific functions:

  • E248R ΔExt: Lacking the external protein domain

  • E248R ΔTM: Lacking the transmembrane domain

  • E248R ΔExt+TM: Lacking both transmembrane and external domains

These deletion studies have revealed that the transmembrane domain is critical for the interaction with NPC1. Mutants lacking the TM domain (E248R ΔTM and E248R ΔExt+TM) fail to interact with NPC1, while the wild-type E248R and E248R ΔExt (which retains the TM domain) maintain this interaction .

This suggests that the TM domain either directly mediates binding to NPC1 or is required for proper protein folding or localization that enables this interaction. These findings have important implications for understanding the molecular mechanisms of viral entry and for designing targeted interventions.

What contradictions exist in current E248R research findings?

While research on E248R has provided significant insights into its structure and function, several contradictions or knowledge gaps exist in the current literature:

  • Functional redundancy vs. specificity: Some studies suggest functional overlap between E248R and E199L in interacting with endosomal proteins , while others indicate more specific, non-redundant roles.

  • Domain specificity inconsistencies: Some pull-down experiments suggest E248R may interact with multiple NPC1 domains (A, C, and I) , while reverse co-immunoprecipitation experiments more specifically identify the C domain as the primary interaction site.

  • Experimental methodology limitations: Different experimental approaches have sometimes yielded varying results, highlighting the importance of methodological considerations in interpreting protein-protein interaction data.

These contradictions point to areas requiring further research and highlight the complexity of viral-host protein interactions. They also underscore the importance of employing multiple complementary experimental approaches to validate findings in this field.

What methodological approaches are most effective for studying E248R-host protein interactions?

Based on the current literature, several methodological approaches have proven effective for studying E248R-host protein interactions:

  • Co-immunoprecipitation with epitope-tagged proteins: This approach has been successfully used to identify interactions between E248R and host endosomal proteins. Both GFP-tagged and HA-tagged versions of E248R have been used effectively .

  • Reciprocal co-immunoprecipitation: Confirming interactions through pull-downs from both directions (e.g., pulling down E248R to detect NPC1 and pulling down NPC1 to detect E248R) provides stronger evidence for specific interactions .

  • Domain deletion analysis: Creating deletion mutants lacking specific protein domains helps identify which regions are essential for protein-protein interactions .

  • Heterologous expression systems: HEK 293T cells have proven useful for protein-protein interaction studies due to their high transfection efficiency .

  • Functional validation studies: Beyond identifying physical interactions, studies using RNAi knockdown or CRISPR knockout of host factors can validate the functional significance of identified interactions .

A comprehensive approach that combines these methods provides the most robust evidence for protein-protein interactions and their functional significance.

How can the E248R-NPC1 interaction be targeted for antiviral development?

The interaction between E248R and NPC1 represents a promising target for antiviral development based on several considerations:

  • Essential for viral entry: Disruption of this interaction prevents viral escape from endosomes, effectively blocking infection at an early stage .

  • Specific binding domain identified: The identification of the C domain of NPC1 as the primary interaction site provides a specific target for intervention .

  • Structural basis: Further structural studies of this interaction could enable structure-based drug design targeting the specific binding interface.

Potential approaches for targeting this interaction include:

  • Small molecule inhibitors: Compounds that bind to either the TM domain of E248R or the C domain of NPC1 could disrupt the interaction.

  • Peptide-based inhibitors: Peptides derived from the interaction interface could competitively inhibit binding.

  • Antibody-based approaches: Antibodies targeting the relevant domains could block the interaction.

  • Host-directed antivirals: Compounds that modulate NPC1 function without completely disrupting its cellular role could provide a balance between antiviral efficacy and host toxicity.

Such approaches would likely have a high barrier to resistance since they target a host-virus interface rather than a viral component alone.

What are the key controls needed when studying E248R-host protein interactions?

When studying E248R-host protein interactions, several controls are essential to ensure data reliability:

  • Negative interaction controls: Include an unrelated protein with similar characteristics (e.g., membrane association, similar size) to demonstrate specificity of observed interactions. For example, studies have used HA-eIF4E as a negative control to verify E248R-NPC1 interaction specificity .

  • Loading controls: Include cellular housekeeping proteins such as GAPDH, alpha-tubulin, or HSP90 to ensure equal loading across samples .

  • Expression controls: Include analysis of input samples (total cell lysates) to confirm expression of all proteins being studied before immunoprecipitation .

  • Antibody specificity controls: Validate antibody specificity through western blotting of known positive and negative samples.

  • Reciprocal co-immunoprecipitation: Confirm interactions by performing pull-downs in both directions to strengthen evidence for specific binding.

Implementation of these controls helps distinguish genuine protein-protein interactions from experimental artifacts and provides greater confidence in research findings.

What cell types are most appropriate for studying E248R function?

The choice of cell type for studying E248R function depends on the specific research question:

  • HEK 293T cells: These cells have been extensively used for protein-protein interaction studies due to their high transfection efficiency and ease of culture . They are particularly useful for initial characterization of protein-protein interactions.

  • Macrophage cell lines: As natural host cells for ASFV, macrophage cell lines provide a more physiologically relevant context for studying E248R function in viral infection. Porcine macrophage lines are particularly relevant.

  • Vero cells: These cells have been used for studies involving recombinant ASFV with inducible E248R expression .

  • Porcine primary cells: For the most physiologically relevant context, primary porcine macrophages or other primary cells derived from the natural host provide valuable insights, though they may be more challenging to work with.

The optimal approach often involves confirming findings across multiple cell types, starting with more tractable systems like HEK 293T cells for initial characterization before moving to more physiologically relevant but technically challenging systems.

How can contradictory findings in E248R research be reconciled?

When faced with contradictory findings in E248R research, several approaches can help reconcile discrepancies:

  • Methodological variations analysis: Carefully compare experimental methods between studies, as differences in protein expression levels, cell types, detection methods, or buffer conditions can significantly impact results.

  • Replication with standardized protocols: Attempt to replicate contradictory findings using standardized protocols to determine if methodological differences explain the discrepancies.

  • Computational analysis tools: Employ advanced tools for clinical contradiction detection that can systematically identify and analyze conflicting statements in the literature .

  • Meta-analysis approaches: When multiple studies exist, formal meta-analysis can help identify patterns and reconcile apparently contradictory findings.

  • Combined methodological approaches: Use multiple complementary techniques to address the same question, as consistency across different methodological approaches strengthens confidence in results.

The field of contradiction detection in scientific literature has developed sophisticated approaches that can be applied to reconcile conflicting findings in E248R research .

What are the most promising avenues for future E248R research?

Several promising research directions could significantly advance our understanding of E248R:

  • Structural biology approaches: High-resolution structural studies of E248R, particularly in complex with NPC1, would provide valuable insights for structure-based drug design.

  • Systems biology integration: Integrating E248R-host interaction data into broader virus-host interaction networks could reveal new functional connections and potential intervention points.

  • Comparative virology: Comparing E248R with functionally similar proteins in other viruses, such as the L1R protein in vaccinia virus which also interacts with NPC1 , could reveal evolutionary patterns and conserved mechanisms.

  • In vivo validation: Testing the importance of E248R-NPC1 interactions in animal models would validate the physiological relevance of findings from cell culture systems.

  • Immunological studies: Investigating the potential of E248R as a target for protective immune responses could inform vaccine development strategies.

These approaches, particularly when pursued in combination, hold promise for advancing both basic understanding of ASFV biology and applied aspects of antiviral development.

How might advances in structural biology enhance our understanding of E248R function?

Structural biology approaches could provide transformative insights into E248R function:

  • Cryo-electron microscopy: This technique could reveal the structure of E248R in the context of the intact virion, providing insights into its spatial relationships with other viral proteins.

  • X-ray crystallography: Determination of the crystal structure of E248R, particularly in complex with NPC1 domains, would provide atomic-level details of the interaction interface.

  • NMR spectroscopy: For specific domains or fragments of E248R, NMR could provide information about dynamic properties and conformational changes.

  • Molecular dynamics simulations: Computational approaches based on structural data could predict how E248R interacts with membranes and how these interactions change during the fusion process.

  • Hydrogen-deuterium exchange mass spectrometry: This technique could identify regions of E248R that undergo conformational changes upon binding to NPC1 or other partners.

These structural insights would not only enhance our understanding of E248R function but could also guide the development of targeted interventions to disrupt its role in viral infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.