Recombinant African swine fever virus Protein E248R (Ba71V-132)

Shipped with Ice Packs
In Stock

Description

Protein Features

The E248R protein (Ba71V-132) is a late structural component of the ASFV virion, localized to the inner envelope. Key structural attributes include:

  • Myristoylation: A post-translational modification at the N-terminus, enhancing membrane association .

  • Transmembrane Domain: A hydrophobic region near the C-terminus, integral to its role as a viral membrane protein .

  • Disulfide Bonds: Intramolecular bonds formed via the ASFV-encoded redox system, critical for protein stability .

  • Homology: Shares 16.2% identity and 30.7% similarity with vaccinia virus (VACV) L1R, a fusion-related protein .

ParameterValueSource
Protein LengthMet1-Asn199 (199 amino acids)
Molecular Weight24.14 kDa
Expression SystemE. coli
Purity>90% (SDS-PAGE)

Key Observations

  • Infectivity Defect: Virions lacking E248R exhibit reduced infectivity (>100-fold) due to impaired early post-entry processes, including cytopathic effect induction and gene expression .

  • Membrane Fusion: Interacts with the host cholesterol transporter NPC1 via its transmembrane domain, mimicking Ebola virus (EBOV) entry mechanisms . Disruption of NPC1 or NPC2 in host cells significantly reduces ASFV replication .

  • Virion Assembly: Not essential for virus particle formation, as E248R-deficient virions retain normal morphology and exit host cells .

Experimental Models

A conditional lethal mutant (vE248Ri) was engineered to study E248R function:

ConditionpE248R ExpressionViral Phenotype
Permissive (IPTG)InducedWild-type infectivity
Restrictive (No IPTG)SuppressedNon-infectious, defective post-entry

Production Details

The recombinant E248R protein is produced in E. coli as an N-terminal His-tagged fusion protein (Met1-Asn199) .

ApplicationRelevanceSource
ELISAAntigen detection in serological assays
Western Blot (WB)Protein expression confirmation
ImmunogenAntibody production (e.g., rabbit IgG)
Bioactivity TestingFunctional studies (e.g., NPC1 binding)

Antibody Development

A polyclonal antibody (PVV36801) specific to E248R has been developed for:

  • ELISA: 1:4000–1:8000 dilution .

  • WB: 1:1000–1:4000 dilution .

Key Interactions

  1. NPC1: E248R binds NPC1’s loop C domain, similar to EBOV’s interaction mechanism. This interaction is critical for viral endosomal escape .

  2. Cytoskeleton Proteins: Associates with actin, tubulin, and cadherin, potentially modulating host cell trafficking .

  3. Rab Proteins: Interacts with geranylgeranyltransferase-related pathways, suggesting a role in vesicle transport regulation .

Research Implications

  • Therapeutic Targeting: NPC1 inhibitors (e.g., U18666A) reduce ASFV infection, highlighting NPC1 as a candidate antiviral target .

  • Diagnostic Tools: Recombinant E248R and its antibodies enable ASFV detection and serological testing .

  • Vaccine Development: Structural insights into E248R’s disulfide bonds and NPC1 interaction may inform vaccine design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Ba71V-132; E248R; Protein E248R; pE248R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-248
Protein Length
Full Length of Mature Protein
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Target Names
Ba71V-132
Target Protein Sequence
GGSTSKNSFKNTTNIISNSIFNQMQNCISMLDGKNYIGVFGDGNILNHVFQDLNLSLDTS CVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLTTTLIQN CVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYT SKNFFDFIADAISAVFKNIMVAAVVIVLIIVGFIAVFYFLHSRHRHEEEEEAEPLISNKV LKNAAVS
Uniprot No.

Target Background

Function

Likely involved in an early post-entry event.

Database Links

KEGG: vg:22220360

Protein Families
Asfivirus E248R family
Subcellular Location
Host membrane; Single-pass type II membrane protein. Virion.

Q&A

What is the structural characterization of ASFV protein E248R?

E248R is a late structural component of the African swine fever virus (ASFV) particle with several distinct structural features. This protein is characterized as a type II myristoylated transmembrane protein composed of three main domains: an N-terminal portion of 199 amino acids containing four cysteine residues oriented toward the cytoplasm, a helical hydrophobic transmembrane domain of 21 amino acids, and a 28 amino acid length extracellular region .

The protein contains intramolecular disulfide bonds formed through the ASFV-encoded redox system, with a distribution pattern of cysteine residues suggesting similarity to vaccinia virus L1R fusion protein . Analysis of its sequence reveals approximately 16.2% identity and 30.7% similarity with VACV L1R fusion protein, particularly in the arrangement of disulfide bonds between specific amino acid positions .

Methodologically, structural characterization has been conducted through comparative sequence analysis, biochemical fractionation, and immunological techniques. Researchers interested in further structural studies should consider combining computational prediction methods with experimental validation using site-directed mutagenesis.

What role does E248R play in ASFV replication and viral infectivity?

E248R plays a critical role in ASFV infectivity, particularly during the early post-entry stage of the viral replication cycle. Experimental evidence using a conditional lethal ASFV mutant (vE248Ri) with an inducible copy of the gene E248R has demonstrated that this protein is essential for virus infectivity .

The protein's significance becomes particularly evident when examining its interactions with cellular components. E248R interacts with the host cellular protein NPC1 (Niemann-Pick C1) through its transmembrane domain . This interaction occurs specifically with the C domain of NPC1, similar to how Ebola virus glycoprotein interacts with NPC1 . This finding suggests E248R's critical role in mediating viral membrane fusion and facilitating the penetration of the viral core into the cytoplasm.

Methodologically, researchers have established this function through:

  • Development of conditional lethal mutants using inducible promoter systems (p72.I)

  • Co-immunoprecipitation assays to detect protein-protein interactions

  • Domain mapping through deletion mutants to identify functional regions

The evidence indicates E248R is required for an early post-entry event but not for virus assembly .

How does E248R interact with host cellular proteins, particularly NPC1?

E248R interacts specifically with the endosomal cholesterol transporter protein NPC1, a critical host factor for viral entry. This interaction was demonstrated through co-immunoprecipitation assays where HA-tagged E248R and Flag-tagged NPC1 were co-expressed in HEK 293T cells . The specificity of this interaction was confirmed by the absence of interaction between NPC1 and an independent control protein (HA-eIF4E) .

To map the specific domains involved in this interaction, researchers created deletion mutants of E248R lacking either the external domain (ΔExt), transmembrane domain (ΔTM), or both (ΔExt+TM) . The results revealed that E248R interacts with NPC1 through its transmembrane domain, as mutants lacking this domain showed no interaction with NPC1 .

Furthermore, reciprocal co-immunoprecipitation experiments identified that E248R specifically interacts with the C domain of NPC1 . This is particularly significant because the C domain of NPC1 is also targeted by Ebola virus glycoprotein during viral entry, suggesting a conserved mechanism between these different viruses.

Methodologically, researchers studying similar viral-host protein interactions should:

  • Design appropriate epitope-tagged constructs for both viral and host proteins

  • Generate domain deletion mutants to map interaction sites

  • Perform bidirectional co-immunoprecipitation assays to confirm specificity

  • Use appropriate negative controls (such as unrelated proteins) to validate results

What experimental approaches are most effective for studying E248R-host protein interactions?

Based on successful research methodologies documented in the literature, the following approaches are most effective for studying E248R-host protein interactions:

  • Co-immunoprecipitation (Co-IP) assays: This technique has proven valuable in identifying the interaction between E248R and NPC1 . For optimal results:

    • Express epitope-tagged proteins (HA-E248R and NPC1-Flag) in mammalian expression systems

    • Use HEK 293T cells for high transfection efficiency

    • Perform reciprocal pull-downs (pulling down with anti-HA and anti-Flag separately)

    • Include appropriate controls (such as HA-eIF4E) to confirm specificity

  • Domain mapping through deletion mutants: Generation of targeted deletions (ΔExt, ΔTM, ΔExt+TM) has successfully identified the transmembrane domain of E248R as critical for NPC1 interaction . This approach should:

    • Target predicted functional domains based on computational analysis

    • Ensure deletion constructs maintain proper folding when possible

    • Verify expression levels of all mutants are comparable

  • Domain-specific interaction studies: Creating constructs expressing individual domains of host proteins (e.g., NPC1 domains A, C, and I) can pinpoint specific interaction interfaces .

  • Virus-based approaches: Using recombinant viruses with inducible expression of E248R (such as vE248Ri) provides a powerful system to study the functional consequences of E248R-host interactions in the context of viral infection .

How is E248R post-translationally modified, and what is the significance of these modifications?

E248R undergoes two significant post-translational modifications that are critical for its function:

  • Myristoylation: E248R contains a putative myristoylation site and has been experimentally confirmed to be myristoylated during infection . This modification involves the covalent attachment of myristic acid to an N-terminal glycine residue and likely contributes to the protein's membrane association properties. Researchers interested in studying this modification should:

    • Use metabolic labeling with radioactive myristic acid precursors

    • Consider site-directed mutagenesis of the myristoylation consensus sequence

    • Employ mass spectrometry to confirm the modification

  • Disulfide bond formation: E248R contains intramolecular disulfide bonds and has been identified as a substrate of the ASFV-encoded redox system . The cysteine residue distribution in E248R suggests similarity to vaccinia virus L1R protein, with potential disulfide bonds between amino acids positions similar to those in L1R (between positions 28-62 and 122-156) . These disulfide bonds likely contribute to the protein's structural stability and function. To study these modifications:

    • Use non-reducing versus reducing SDS-PAGE to detect mobility shifts

    • Apply mass spectrometry techniques to map specific disulfide linkages

    • Employ cysteine-to-serine mutations to assess functional consequences

The combination of these modifications likely plays a critical role in ensuring E248R's proper localization and function within the viral particle. The myristoylation facilitates membrane association, while disulfide bonds provide structural integrity necessary for interactions with host factors like NPC1.

How does E248R associate with membranes and what is its localization in infected cells?

E248R exhibits specific membrane association properties and localization patterns essential for its function in the viral life cycle:

  • Membrane integration: E248R behaves as an integral membrane protein, associating with the membrane fraction in infected cells . This association is likely facilitated by:

    • Its myristoylation, which provides a lipid anchor

    • The hydrophobic transmembrane domain near its carboxy terminus

  • Virion localization: Immunoelectron microscopy and biochemical fractionation studies have shown that E248R specifically localizes to the inner envelope of the virus particles in the cytoplasmic viral factories . This positioning is consistent with its proposed role in membrane fusion during viral entry.

  • Membrane topology: As a type II transmembrane protein, E248R has a specific orientation with respect to the membrane :

    • The N-terminal portion (199 amino acids) containing four cysteine residues is oriented toward the cytoplasm

    • The 21-amino acid hydrophobic transmembrane domain spans the lipid bilayer

    • The 28-amino acid C-terminal portion extends into the extracellular/luminal space

For researchers interested in studying membrane association and localization, the following methodological approaches are recommended:

  • Subcellular fractionation with differential centrifugation

  • Membrane extraction using increasing detergent concentrations

  • Immunofluorescence microscopy with domain-specific antibodies

  • Protease protection assays to determine membrane topology

What is the role of E248R in ASFV membrane fusion and viral core release?

E248R appears to play a critical role in ASFV membrane fusion and viral core release into the cytoplasm, based on several lines of evidence:

  • Interaction with endosomal proteins: E248R interacts specifically with NPC1, a late endosomal (LE) integral membrane protein involved in cholesterol transport . This interaction occurs through E248R's transmembrane domain and specifically targets the C domain of NPC1 . This mirrors the strategy employed by Ebola virus, which also uses NPC1 as a receptor during entry.

  • Structural homology to fusion proteins: E248R shares homology with vaccinia virus L1R fusion protein (16.2% identity and 30.7% similarity) , suggesting a potential role in membrane fusion events.

  • Location within the virion: As a component of the inner viral envelope, E248R is positioned to participate in fusion between the viral membrane and the endosomal membrane following virion decapsidation .

  • Functional studies with conditional mutants: Research using a conditional lethal ASFV mutant (vE248Ri) has demonstrated that E248R is required for an early post-entry event but not virus assembly , consistent with a role in membrane fusion and core release.

The current model suggests that following ASFV entry into cells via endocytosis and progression to late endosomes, E248R (along with E199L) interacts with NPC1 to facilitate fusion between the viral and endosomal membranes, allowing the release of the viral core into the cytoplasm . This process appears to be connected to cholesterol efflux in late endosomal vesicles, as NPC1 is a critical cholesterol transporter.

How do E248R and E199L cooperate in ASFV entry mechanisms?

E248R and E199L appear to function cooperatively during ASFV entry, particularly in mediating fusion between viral and cellular membranes:

  • Complementary structure and localization: Both E248R and E199L are transmembrane proteins located in the inner envelope of the virus particle . While E248R is a type II transmembrane protein with its N-terminus facing the cytoplasm, E199L is a type I transmembrane protein with its N-terminal portion oriented internally to the viral particle .

  • Shared interaction partner: Both proteins interact with the endosomal protein NPC1, specifically through its C domain . This suggests they may form part of a fusion complex that engages with host factors.

  • Homology to poxvirus fusion machinery: E248R shares homology with vaccinia virus L1R fusion protein, while E199L shares homology with three cysteine-enriched proteins belonging to the fusion machinery of vaccinia virus (A16, A26, and G9) . This suggests they may play complementary roles similar to the multi-component fusion machinery of poxviruses.

  • Cysteine-rich regions and disulfide bonds: Both proteins contain cysteine-rich regions that form disulfide bonds, which are likely important for their structural integrity and function . These disulfide bonds are formed through the ASFV-encoded redox system.

The current model suggests that following ASFV entry into cells via endocytosis and progression to late endosomes, both E248R and E199L engage with NPC1 to facilitate fusion between the viral and endosomal membranes . This interaction may trigger conformational changes that drive membrane fusion, leading to the release of the viral core into the cytoplasm.

How can conditional lethal ASFV mutants be generated for E248R functional studies?

Generation of conditional lethal mutants has proven valuable for studying essential viral proteins like E248R. Based on published methodologies, researchers should consider the following approach:

  • Inducible promoter system: The key to creating conditional mutants is establishing an inducible expression system. For E248R studies, researchers have successfully used the inducible promoter p72.I , which consists of:

    • The synthetic late promoter p72.4

    • The E. coli lac operator positioned 6 bp from the promoter

    • The lacZ gene under the control of the late promoter p72

  • Construction of transfer vectors:

    • Create an intermediate transfer vector (e.g., pIND1) containing the inducible promoter system

    • Insert the complete E248R open reading frame into this vector to create pIND1.E248R

    • Include flanking sequences to direct homologous recombination into the viral genome

  • Viral recombination:

    • Transfect cells with the transfer vector and infect them with parent virus

    • Select recombinant viruses using appropriate markers (e.g., β-galactosidase expression)

    • Purify recombinant viruses through plaque purification

  • Characterization of conditional mutants:

    • Verify the presence of the inducible E248R gene by PCR and sequencing

    • Confirm that virus replication is dependent on inducer presence

    • Assess viral phenotype under permissive and non-permissive conditions

This system allows researchers to control E248R expression and determine at which stage of the viral life cycle the protein is required. Similar approaches have successfully demonstrated that E248R is required for an early post-entry event but not virus assembly .

What expression systems are most suitable for producing recombinant E248R for in vitro studies?

For researchers aiming to produce recombinant E248R for biochemical and structural studies, several expression systems have been successfully employed:

  • Bacterial expression systems:

    • The pRSETA vector system has been used for E248R expression in E. coli

    • This approach is suitable for producing protein for antibody generation and basic biochemical studies

    • Considerations: May lack post-translational modifications (myristoylation, disulfide bonds) critical for function

  • Mammalian expression systems:

    • The pcDNA 3.1 vector has been used for E248R expression in mammalian cells

    • Construction method: Excise the complete coding sequence of E248R using restriction enzymes (EcoRI and BamHI) and clone into the vector

    • This system is ideal for interaction studies and analyzing post-translational modifications

    • HEK 293T cells have been successfully used for expression due to their high transfection efficiency

  • Viral expression systems:

    • Recombinant viruses with inducible expression (e.g., vE248Ri) provide a powerful system for studying E248R in the context of viral infection

    • This approach ensures proper viral factors are present for authentic modification and localization

When selecting an expression system, researchers should consider:

  • The requirement for post-translational modifications (myristoylation, disulfide bonds)

  • Whether membrane association is critical for the planned experiments

  • The need for interaction partners or viral factors

  • The scale of protein production required

For most functional studies, mammalian expression systems are recommended to ensure proper folding, modification, and membrane integration of E248R.

How does E248R compare structurally and functionally to homologous proteins in other viruses?

E248R shares structural and functional similarities with proteins from other large DNA viruses, particularly poxviruses, providing insights into conserved viral entry mechanisms:

  • Vaccinia virus L1R protein: E248R shows 16.2% identity and 30.7% similarity with VACV L1R fusion protein . Key similarities include:

    • Both are myristoylated membrane proteins

    • Both contain intramolecular disulfide bonds formed through virus-encoded redox systems

    • The distribution of cysteine residues suggests similar disulfide bonding patterns

    • Both proteins interact with host factors during viral entry

  • Functional parallels with Ebola virus glycoprotein:

    • Similar to Ebola virus glycoprotein, E248R interacts specifically with the C domain of NPC1

    • This suggests convergent evolution of viral strategies targeting the same host factor for membrane fusion events

    • Both viruses appear to utilize NPC1 to facilitate membrane fusion and viral core release

  • Membership in viral fusion machinery:

    • Like components of the poxvirus entry fusion complex (EFC), E248R appears to be part of a multi-protein complex involved in membrane fusion

    • E248R works in conjunction with E199L, which shares homology with other poxvirus fusion proteins (A16, A26, and G9)

These comparisons suggest that despite limited sequence homology, there are conserved structural and functional features in viral fusion proteins across different virus families. Understanding these commonalities can provide insights into fundamental mechanisms of viral entry and potential broad-spectrum antiviral strategies.

What can evolutionary analysis of E248R across ASFV isolates reveal about its functional conservation?

Evolutionary analysis of E248R reveals it is highly conserved among ASFV isolates, underscoring its essential function in the viral life cycle . Key aspects of this conservation include:

  • Sequence conservation: E248R shows high sequence conservation across different ASFV isolates , indicating strong selective pressure to maintain its structure and function. This conservation is particularly notable in:

    • The myristoylation site

    • The transmembrane domain

    • The positioning of cysteine residues involved in disulfide bond formation

  • Structural domain preservation: The three-domain architecture of E248R (N-terminal cytoplasmic domain, transmembrane domain, and C-terminal extracellular domain) is maintained across isolates , suggesting each plays a critical role in protein function.

  • Functional implications:

    • The high conservation of the transmembrane domain, which mediates interaction with NPC1, indicates the importance of this interaction for viral entry

    • Conservation of cysteine residues suggests the importance of disulfide bonds for proper protein folding and function

    • Preservation of the myristoylation site underscores the significance of membrane association

For researchers interested in performing evolutionary analyses of E248R:

  • Multiple sequence alignment of E248R from diverse ASFV isolates can identify absolutely conserved residues

  • Calculation of selection pressures (dN/dS ratios) can highlight regions under purifying selection

  • Examination of natural variants can provide insights into functionally flexible regions

Such analyses can guide targeted mutagenesis studies and identify potential regions for antiviral development that are less likely to develop resistance mutations.

What are the main methodological challenges in studying E248R function?

Researchers face several significant challenges when investigating E248R function:

  • Membrane protein expression and purification:

    • As an integral membrane protein with post-translational modifications, E248R is challenging to express and purify in its native conformation

    • Expression systems must support myristoylation and disulfide bond formation

    • Detergent selection for extraction from membranes while preserving structure is critical

  • Structural analysis limitations:

    • Traditional structural determination methods (X-ray crystallography, NMR) are challenging for membrane proteins

    • Cryo-EM may offer alternatives but requires stable, homogeneous protein preparations

    • Computational predictions remain limited by the relative scarcity of membrane protein structures

  • Complexity of viral entry:

    • E248R functions as part of a multi-protein complex involving both viral (E199L) and host (NPC1) factors

    • Reconstituting this complex for in vitro studies presents significant technical hurdles

    • Temporal dynamics of these interactions during infection are difficult to capture

  • BSL-3 containment requirements:

    • ASFV requires biosafety level 3 containment, limiting the facilities where live virus experiments can be conducted

    • This necessitates development of surrogate systems or pseudotyped particles that recapitulate E248R function

Future methodological approaches that may overcome these challenges include:

  • Nanodiscs or lipid cubic phase systems for membrane protein stabilization

  • Single-particle tracking to monitor E248R dynamics during entry

  • Cryo-electron tomography of virions to visualize E248R in situ

  • Development of cell-free membrane fusion assays to study E248R function

What research questions about E248R remain unanswered?

Despite significant progress in understanding E248R, several important questions remain unresolved:

  • Structural determinants of function:

    • What is the three-dimensional structure of E248R?

    • Which specific residues mediate the interaction with NPC1?

    • How do disulfide bonds influence protein conformation and function?

  • Mechanism of membrane fusion:

    • Does E248R undergo conformational changes during membrane fusion?

    • What triggers these changes (pH, receptor binding, etc.)?

    • How do E248R and E199L coordinate to drive membrane fusion?

  • Role in viral tropism and pathogenesis:

    • Do variations in E248R contribute to differences in cell tropism among ASFV isolates?

    • How does E248R function in natural host cells versus laboratory cell lines?

    • Can E248R be targeted for attenuation in vaccine development?

  • Host factor interactions beyond NPC1:

    • Does E248R interact with additional host factors?

    • How does cholesterol content influence E248R function?

    • Are there host restriction factors that target E248R?

  • Potential as an antiviral target:

    • Can small molecules disrupt the E248R-NPC1 interaction?

    • Would targeting E248R lead to resistance development?

    • Can neutralizing antibodies effectively target E248R?

Addressing these questions will require interdisciplinary approaches combining structural biology, virology, cell biology, and biochemistry. The development of new techniques for studying membrane proteins and membrane fusion events will be particularly valuable for advancing our understanding of E248R function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.