Recombinant African swine fever virus Protein E248R (Mal-140)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type in advance for preferential development.
Synonyms
Mal-140; k2R; Protein E248R; pE248R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-236
Protein Length
Full Length of Mature Protein
Species
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Target Names
Mal-140
Target Protein Sequence
GGSTSKYSFKNTTNIISHSIFNQMQNCISMLDGKNYIGVFGDGNIINHVFQDLNLSLNTS CVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLKTTLIQN CVSALSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYT SKNFFDFIADAISAVFKNIMVAAVVIVLIIVGFIAVFYFLHSRTAMRRRKKLNRS
Uniprot No.

Target Background

Function

Likely involved in an early post-entry event.

Protein Families
Asfivirus E248R family
Subcellular Location
Host membrane; Single-pass type II membrane protein. Virion.

Q&A

What is the E248R protein and what are its primary structural features?

E248R is a late structural component of the African swine fever virus (ASFV) particle with several distinctive structural features. The protein contains intramolecular disulfide bonds and has been identified as a substrate of the ASFV-encoded redox system . It is a type II transmembrane protein comprising three distinct domains: an N-terminal cytoplasmic domain (amino acids 1-199) containing four cysteine residues involved in disulfide bond formation, a hydrophobic transmembrane domain (amino acids 200-220) critical for membrane association, and a short C-terminal extracellular domain (amino acids 221-248). The protein's amino acid sequence contains a putative myristoylation site, which has been confirmed to be functional during viral infection .

How does the Mal-140 truncated variant differ from the full-length E248R protein?

The Mal-140 variant of E248R is a truncated form engineered specifically for research applications, containing only the first 140 amino acids of the native protein. This partial protein retains the N-terminal cytoplasmic domain and a portion of the transmembrane domain but lacks the complete transmembrane helix and the extracellular C-terminal region. This selective truncation maintains key functional domains for experimental utility while excluding non-essential regions, making it valuable for structure-function relationship studies and as an antigen for antibody production .

What post-translational modifications occur in E248R protein?

The E248R protein undergoes two critical post-translational modifications that influence its functionality:

  • Myristoylation: This lipid modification occurs at the N-terminal glycine residue and is essential for proper membrane anchoring and localization . During infection, E248R is myristoylated and subsequently associates with membrane fractions in infected cells, behaving as an integral membrane protein .

  • Disulfide bond formation: The protein contains intramolecular disulfide bonds that stabilize its cytoplasmic domain structure . These bonds are formed via the ASFV-encoded redox system, which has been identified as interacting with E248R .

At which specific stage of viral entry does E248R function?

  • Membrane fusion: E248R facilitates fusion between the viral inner envelope and host endosomal membranes.

  • Core penetration: It enables the release of viral genetic material into the cytoplasm for subsequent replication.

These findings position E248R as essential for an early post-entry event, specifically in the membrane fusion and core release steps of viral entry.

What cellular interactions have been identified for E248R protein?

A significant interaction partner for E248R is the cholesterol transporter Niemann-Pick C1 (NPC1). The transmembrane domain of E248R directly interacts with specific domains of NPC1, suggesting a mechanism by which the virus exploits host cholesterol transport machinery during infection. This interaction appears crucial for the membrane fusion events required for successful viral entry and may represent a potential target for antiviral interventions.

How can E248R gene be utilized in ASFV detection methods?

The E248R gene has been successfully employed as a target for developing sensitive and specific molecular diagnostic assays for ASFV. Researchers have established TaqMan real-time PCR methods targeting conserved regions of the E248R gene sequence for rapid ASFV detection . In one study, primers and probes were designed based on the conserved sequence region of the E248R gene from the ASFV SY18 strain . The resulting assay demonstrated:

  • High specificity with no cross-reactivity with other swine-derived viruses that cause similar clinical symptoms

  • Good repeatability with coefficients of variation between and within groups lower than 1.977%

  • Suitable sensitivity for early diagnosis and detection

This method can be applied not only for direct detection of ASFV infection but also for monitoring recombinant viruses expressing the E248R gene in vaccine development platforms .

What are the protocols for cloning and expressing recombinant E248R protein?

For recombinant expression of the E248R gene, the following methodology has been documented:

  • Gene synthesis and vector construction: The complete E248R gene (747 bp) is synthesized based on reference sequences (e.g., GenBank accession number: MH766894) and cloned into appropriate vectors (such as pUC57) .

  • Amplification and purification: The construct is amplified in E. coli (e.g., Top 10 strain), purified using plasmid extraction kits, and quantified via spectrophotometry .

  • Copy number calculation: For quantitative applications, copy numbers can be calculated using the formula: Amount (copies/μL) = [DNA concentration (g/μL) × 6.23 × 10^14]/(plasmid length in base pairs × 324.5 × 2) .

  • Viral vector expression systems: For studying E248R in a viral context, recombinant viruses (such as PRRSV) expressing the E248R gene can be constructed by inserting the gene into the viral genome using reverse genetics platforms .

  • Verification of expression: Expression can be confirmed using techniques such as indirect immunofluorescence assay (IFA) with specific antibodies against E248R .

What experimental design considerations are important when working with recombinant E248R proteins?

When designing experiments with recombinant E248R proteins, researchers should consider:

  • Domain selection: For truncated variants like Mal-140, careful consideration of which domains to include based on the research question is essential. The N-terminal domain (amino acids 1-140) maintains key functional elements while excluding regions that might complicate expression or purification.

  • Post-translational modifications: Since myristoylation and disulfide bond formation are critical for E248R function, expression systems should be selected that can perform these modifications correctly .

  • Membrane protein handling: As E248R is an integral membrane protein, appropriate detergents and buffer conditions must be employed during purification and functional studies .

  • Stability monitoring: When using recombinant viruses expressing E248R, genetic stability should be monitored across multiple passages. Studies have confirmed stability through at least 20 passages in vitro, which can be verified using quantitative PCR and immunofluorescence assays .

How can structure-function relationships of E248R be investigated experimentally?

To study structure-function relationships of E248R, several complementary approaches can be implemented:

  • Site-directed mutagenesis: Systematic mutation of key residues in each domain (particularly the myristoylation site, cysteine residues involved in disulfide bonds, and transmembrane domain) followed by functional assays can reveal critical amino acids for specific functions .

  • Domain swapping experiments: Exchanging domains between E248R and related viral proteins can help identify which regions mediate specific functions.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid, or proximity ligation assays can map interactions between E248R and viral or cellular proteins, particularly focusing on the NPC1 interaction.

  • Recombinant virus systems: Construction of ASFV mutants with inducible or conditional expression of modified E248R variants allows for assessment of function in the complete viral lifecycle .

A comprehensive experimental design should incorporate both in vitro biochemical assays and cellular infection models to fully characterize the protein's functional domains.

What are the current challenges in studying the membrane fusion mechanism of E248R?

Investigating the precise mechanism by which E248R mediates membrane fusion presents several methodological challenges:

  • Reconstitution of membrane environments: Creating artificial membrane systems that accurately reflect the composition of viral envelopes and endosomal membranes is technically demanding.

  • Temporal resolution: Capturing the dynamic process of membrane fusion requires sophisticated live imaging techniques with high temporal resolution.

  • Structural biology limitations: As a membrane protein with multiple domains, E248R presents challenges for structural determination by techniques such as X-ray crystallography or cryo-electron microscopy.

  • Distinguishing direct and indirect effects: Determining whether E248R directly mediates fusion or recruits/activates other fusion factors requires careful experimental design with appropriate controls.

Researchers addressing these challenges might employ liposome fusion assays, single-particle tracking, super-resolution microscopy, or in vitro reconstitution systems with purified components to dissect the fusion mechanism step by step.

How can E248R be utilized in the development of next-generation ASFV vaccines?

E248R protein offers several promising avenues for vaccine development strategies:

  • Recombinant vector vaccines: The E248R gene has been successfully inserted into porcine reproductive and respiratory syndrome virus (PRRSV) vaccine strain HuN4-F112 to create a recombinant viral vector . This approach could generate dual protection against both PRRSV and ASFV.

  • Subunit vaccines: The Mal-140 truncated variant retains critical epitopes while eliminating domains that might complicate manufacturing or safety. This makes it a candidate for subunit vaccine formulations.

  • Rationalized attenuation: Since E248R deletion reduces viral infectivity without preventing assembly or release, targeted modifications to this protein could contribute to the development of rationally attenuated live virus vaccines that maintain immunogenicity while reducing virulence .

  • Diagnostic differentiation: Recombinant E248R-based vaccines can be designed with epitope tags or specific modifications that allow for serological differentiation between infected and vaccinated animals (DIVA strategy) .

The stability of E248R expression in recombinant vector platforms, as demonstrated through multiple passages, supports its utility in vaccine applications .

How does E248R compare to functionally similar proteins in other viruses?

E248R appears to have functional parallels with fusion-mediating proteins from other enveloped viruses, though with distinct structural characteristics. A comparative analysis reveals:

Virus FamilyFusion ProteinStructural ClassActivation MechanismCellular Receptor Interaction
ASFV (Asfarviridae)E248RType II transmembrane proteinPost-endocytic, possibly pH-dependentInteracts with NPC1
HerpesviridaegB, gH/gLClass III fusion proteinsComplex, multi-componentMultiple glycoproteins required
FlaviviridaeE proteinClass II fusion proteinspH-dependentPre-fusion dimers to post-fusion trimers
CoronaviridaeS proteinClass I fusion proteinsProtease cleavage, pH changesReceptor binding triggers conformational changes

Unlike many viral fusion proteins that project extensively from the virion surface, E248R has a short extracellular domain and appears to function primarily through its transmembrane and cytoplasmic domains . This unusual topology suggests a distinct mechanism of action compared to better-characterized viral fusion systems.

What are the implications of E248R-NPC1 interaction for antiviral strategies?

The interaction between E248R and the cellular cholesterol transporter NPC1 presents intriguing possibilities for antiviral intervention:

  • Small molecule inhibitors: Compounds targeting either the E248R transmembrane domain or the interacting regions of NPC1 could potentially block this interaction and inhibit viral entry.

  • Cholesterol metabolism modulation: Since NPC1 is involved in cholesterol transport, agents that modify cellular cholesterol distribution might indirectly affect E248R function during entry.

  • Peptide-based inhibitors: Synthetic peptides mimicking the interaction interfaces could competitively inhibit the E248R-NPC1 binding.

  • Host-directed therapeutics: Rather than targeting viral proteins directly, drugs modulating NPC1 expression or localization might have broader antiviral effects.

This interaction parallels the established role of NPC1 in Ebola virus entry, suggesting potential commonalities in entry mechanisms between these distinct viral families that could be exploited for broad-spectrum antiviral development.

What questions remain unresolved regarding E248R structure and function?

Despite significant advances in understanding E248R, several critical questions remain unanswered:

  • High-resolution structure: The three-dimensional structure of E248R has not been determined, limiting our understanding of how its domains coordinate functionally.

  • Fusion mechanism: The precise biophysical mechanism by which E248R mediates membrane fusion, including any conformational changes involved, remains poorly characterized.

  • Regulatory elements: How E248R activity is regulated during infection (e.g., triggers for activation, timing of function) is not fully understood.

  • Interaction network: Beyond NPC1, the complete set of viral and cellular proteins that interact with E248R during the viral lifecycle has not been comprehensively mapped.

  • Immunological significance: Whether E248R serves as a significant target for protective immunity, and which epitopes might be most relevant for vaccine development, requires further investigation.

Addressing these questions will require interdisciplinary approaches combining structural biology, advanced imaging, biochemistry, and immunology to fully elucidate the multifaceted roles of this protein in ASFV infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.