Recombinant African swine fever virus Protein H108R (Ken-129)

Shipped with Ice Packs
In Stock

Description

Virulence and Genetic Diversity

  • Virulence Attenuation: Deletion of the H108R gene in the pandemic ASFV-Georgia2007 strain (ASFV-G-ΔH108R) reduced virulence in domestic swine, with delayed replication kinetics in macrophages and survival of infected animals .

  • Genetic Conservation: High sequence homology (100% identity) among pandemic Eurasian lineage isolates, except for a S54F substitution in the Georgia 2007/1 strain .

  • Protein Localization: H108R is associated with the inner viral envelope, though its precise function remains unclear .

Transcriptional Profile

  • Late Gene Expression: H108R transcription overlaps with the late protein p72 (B646L), suggesting a role in viral replication or structural assembly .

  • Kinetics: Detectable at 4 hours post-infection (hpi) in swine macrophages, persisting until 24 hpi .

Vaccine Development

  • Attenuated Vaccine Candidates: ASFV-G-ΔH108R conferred protection against parental ASFV-G challenge, highlighting H108R deletion as a strategy to improve vaccine safety .

  • Subunit Vaccine Antigen: Recombinant H108R is used to study immune responses and develop serological assays .

Diagnostic Tools

  • ELISA Kits: Recombinant H108R serves as a coating antigen in enzyme-linked immunosorbent assays for detecting ASFV-specific antibodies .

Challenges and Future Directions

  • Functional Elucidation: The exact role of H108R in viral replication or pathogenesis remains unclear, necessitating structural and functional studies .

  • Genetic Variability: The protein’s length and substitutions (e.g., S54F) may influence antigenicity across ASFV isolates, impacting diagnostic accuracy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please specify them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ken-129; Protein H108R; pH108R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Target Names
Ken-129
Target Protein Sequence
MVNLFPVFTLIVIITILITTRELSTTMLIVSLVTDYIIINTQYTEQHEMNKFSAQQGLQK NSFDESYNKDKKPNTHISYQWLAPELKEAENKYWWGNDDPYSQPVLAGAS
Uniprot No.

Target Background

Protein Families
Asfivirus H108R family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is the H108R gene in African swine fever virus and what role does it play?

The H108R gene encodes a small protein of 108-111 amino acids that has been identified as a significant virulence determinant in African swine fever virus. Recent research demonstrates that this previously uncharacterized gene, when deleted from the virulent ASFV-Georgia2007 (ASFV-G) strain, dramatically reduces virus virulence in domestic swine . The protein encoded by H108R has been localized to the inner envelope of the virus particle, though its precise molecular function remains to be fully characterized . Based on transcriptional profiling, H108R appears to be a late gene, as its expression pattern overlaps with that of the well-characterized late protein p72 (B646L) . While not essential for virus replication, H108R significantly contributes to virulence, as evidenced by the attenuated phenotype of deletion mutants in both cell culture and animal models.

What is known about the genetic diversity of H108R across different ASFV isolates?

The H108R gene shows variation in length and sequence across different ASFV isolates, ranging from 108 to 111 amino acids. Studies examining genetic diversity across nine representative ASFV isolates from different genotypes revealed three main genetic groups . The pandemic Eurasian lineage (represented by Georgia 2007/1) belongs to genetic group I and exhibits a distinctive S54F substitution . Notably, the protein is highly conserved (100% identity) throughout the pandemic Eurasian lineage, indicating its potential importance in the virulence characteristics of this widespread lineage . Some isolates, such as Malawi Lil-20/1, Ken06.Bus, and Kenya 1950, contain a three-amino acid insertion, producing the longer 111-amino acid version of the protein . Additionally, the Kenya 1950 isolate displays a unique deletion at position 47, further contributing to genetic diversity .

How is H108R expressed during the ASFV replication cycle?

Transcriptional analysis of H108R in primary swine macrophages infected with ASFV-G demonstrates that it follows a late gene expression pattern. Time course experiments revealed that H108R transcription is detectable by 4 hours post-infection (hpi) and remains stable until at least 24 hpi . When compared with well-characterized ASFV proteins—early protein p30 (CP204L) and late protein p72 (B646L)—the expression kinetics of H108R closely resembles that of B646L, confirming its classification as a late gene in the virus replication cycle . This temporal expression pattern suggests the protein likely functions during later stages of virion assembly or maturation rather than in early events such as virus entry or initial genome replication.

What methodologies can be used to create H108R deletion mutants in ASFV?

The creation of H108R deletion mutants in ASFV requires sophisticated recombinant DNA technology approaches. Based on published methodologies, researchers have successfully employed homologous recombination techniques to delete the H108R gene from the ASFV genome. In the study with ASFV-G, the H108R gene was replaced with a cassette containing the fluorescent reporter gene mCherry under the control of the ASFV p72 promoter . The methodology involves:

  • Design of homologous flanking regions surrounding the H108R gene

  • Construction of a recombination cassette containing the reporter gene

  • Homologous recombination in infected cells

  • Multiple rounds of limiting dilution purification (16 rounds in the case of ASFV-G-ΔH108R) based on fluorescent marker expression

  • Verification of genomic modifications using Next Generation Sequencing (NGS)

The success of this approach depends on careful design of flanking homologous regions, efficient delivery of the recombination cassette, and rigorous purification to ensure clonal purity. NGS verification is critical to confirm the precise deletion (86 nucleotides from positions 155,233 to 155,318 in the case of ASFV-G-ΔH108R) and insertion of the reporter cassette (1226 nucleotides) while ensuring no unintended modifications occurred elsewhere in the genome .

Alternative approaches, such as CRISPR/Cas9-mediated gene editing or Red/ET recombineering technology (as used for other ASFV genes in search result ), might also be applicable for H108R deletion, though these would require optimization for the specific genomic context.

How does H108R contribute to ASFV virulence mechanisms?

The H108R gene significantly contributes to ASFV virulence through mechanisms that are still being elucidated. Experimental infection of domestic swine with H108R deletion mutants (ASFV-G-ΔH108R) demonstrated dramatic attenuation compared to the parental virulent strain . While animals infected with the parental ASFV-G developed severe clinical signs of ASF and reached euthanasia criteria by day 7 post-infection, four out of five animals infected with ASFV-G-ΔH108R survived the 28-day observation period with only mild, transient fever in three animals, and one animal remained completely asymptomatic .

This attenuation could be related to several potential mechanisms:

  • Delayed replication kinetics: The slower replication observed in vitro may allow the host immune system more time to mount an effective response before the virus reaches damaging levels.

  • Altered host-virus interactions: Given its transmembrane characteristics, H108R may interact with host cell components to modulate inflammatory responses or cell death pathways.

  • Modified virion structure: As H108R localizes to the inner envelope of virus particles, its absence may affect virion stability, assembly, or infectivity.

Comparative analysis with other viral transmembrane proteins suggests that H108R might function similarly to poxvirus proteins like I5L, which enhance viral replication and virulence . The exact molecular interactions and signaling pathways affected by H108R remain important areas for future research.

Can H108R deletion be combined with other gene modifications to develop attenuated ASFV vaccine candidates?

The discovery of H108R as a virulence determinant presents a valuable opportunity for rational vaccine design. Research indicates that deletion of H108R could be incorporated into multivalent attenuation strategies for ASFV vaccine development. While ASFV-G-ΔH108R shows significant attenuation, it still retains some residual virulence, making it a candidate for further modification rather than a standalone vaccine .

Several approaches for combining H108R deletion with other modifications could be considered:

  • Multiple gene deletions: Combining H108R deletion with deletion of other virulence genes, such as those in the multigene families MGF360 and MGF530/505, which have been shown to modulate interferon responses .

  • Deletion combined with gene interruption: Following strategies similar to those used with BeninΔDP148R, where additional genes like EP402R or EP153R were deleted or interrupted .

  • Rational attenuation pathway targeting: Designing combinations that target different virulence pathways, such as combining H108R deletion (affecting replication efficiency) with modifications to genes that interfere with host immune responses.

The authors of the H108R study specifically note that "the deletion of this gene may be used as a tool to increase the attenuation of currently experimental vaccines to improve their safety profiles" , suggesting its utility in multivalent approaches rather than as a standalone modification.

What are the comparative immunological responses to wild-type versus H108R-deleted ASFV?

Animals that survive infection with H108R-deleted ASFV develop robust protective immunity against challenge with virulent parental virus. In experimental studies, pigs that survived ASFV-G-ΔH108R infection developed strong ASFV-specific antibody responses and were completely protected when subsequently challenged with the virulent parental ASFV-G strain . This indicates that despite its attenuation, ASFV-G-ΔH108R preserves the essential antigenic determinants needed to induce protective immunity.

The immunological responses involve:

  • Antibody production: Survivors develop strong ASFV-specific antibody responses, suggesting effective B-cell activation and humoral immunity .

  • Protective efficacy: Even at low doses (10² HAD₅₀), ASFV-G-ΔH108R can confer protection against challenge, indicating potent immunogenicity despite reduced replication .

  • Balanced attenuation and immunogenicity: While significantly attenuated, the virus retains sufficient replication capacity to stimulate protective immune responses, achieving the critical balance required for live attenuated vaccine candidates.

Detailed comparative analyses of specific immune parameters—such as T-cell responses, cytokine profiles, and neutralizing versus non-neutralizing antibody ratios—between wild-type and H108R-deleted ASFV infections would be valuable for future research to fully understand the immunological basis of protection.

How does the conservation of H108R across pandemic ASFV lineages influence vaccine development strategies?

The high conservation of H108R (100% identity) observed throughout the pandemic Eurasian lineage has significant implications for vaccine development strategies . This conservation suggests:

  • Evolutionary constraint: The lack of variation indicates functional importance, potentially making H108R an attractive target for broadly effective intervention strategies.

  • Broad coverage potential: Vaccines based on H108R deletion from current pandemic strains could potentially offer protection against the entire Eurasian lineage, addressing the most urgent current threat.

  • Stability of attenuation: The absence of natural variants suggests that reversion to virulence through natural selection of H108R variants is less likely, potentially enhancing vaccine safety.

  • Cross-protection considerations: While highly conserved in the Eurasian lineage, the existence of three main genetic groups of H108R across all ASFV isolates suggests that vaccines based solely on current pandemic strains might require evaluation for efficacy against diverse ASFV genotypes .

The distinctive S54F substitution in the Georgia 2007/1 isolate (representative of the pandemic lineage) could be particularly relevant for understanding lineage-specific virulence characteristics , potentially informing the development of vaccines specifically targeting this pandemic variant.

What techniques are most effective for studying H108R function in ASFV pathogenesis?

Multiple complementary techniques can be employed to elucidate H108R function in ASFV pathogenesis:

  • Reverse genetics approaches: The development of recombinant viruses with specific H108R modifications (beyond simple deletion) to map functional domains. This could involve targeted mutations of the transmembrane domain (amino acids 6-23) or other conserved regions .

  • Transcriptomics and proteomics: Comparative analysis of host cell responses to wild-type versus H108R-deleted ASFV infection to identify pathways modulated by H108R.

  • Protein interaction studies: Techniques such as co-immunoprecipitation, proximity labeling, or yeast two-hybrid screening to identify viral or host proteins that interact with H108R.

  • Structural biology approaches: Determination of H108R protein structure through X-ray crystallography or cryo-electron microscopy to inform function.

  • In vivo models with targeted readouts: Beyond survival studies, detailed immunopathological analyses of tissues from animals infected with wild-type versus H108R-deleted viruses to understand specific effects on disease progression.

  • Vector expression systems: Similar to approaches used for other ASFV genes, recombinant viral vectors (like the pseudorabies virus system described in search result ) could be used to express H108R independently to study its effects outside the context of ASFV infection.

Combining these approaches would provide complementary insights into H108R function at the molecular, cellular, and organismal levels, contributing to a comprehensive understanding of this virulence factor's role in ASFV pathogenesis.

How might H108R be incorporated into novel diagnostic tests for ASFV?

The high conservation of H108R throughout the pandemic Eurasian lineage makes it a potentially valuable target for diagnostic development. Researchers could develop diagnostic approaches based on:

  • PCR-based detection: Primers targeting the highly conserved regions of H108R could provide sensitive and specific detection of Eurasian lineage ASFV.

  • Serological assays: Recombinant H108R protein could be used as an antigen in ELISA or lateral flow assays to detect ASFV-specific antibodies in recovered animals.

  • Differentiation of Infected from Vaccinated Animals (DIVA) strategies: If H108R-deleted viruses are used as vaccines, diagnostic tests specifically detecting H108R could distinguish infected from vaccinated animals.

  • Genotyping assays: Given the three main genetic groups of H108R identified across ASFV isolates , targeted sequencing of this gene could help rapidly categorize new isolates in outbreak situations.

Any diagnostic development would require extensive validation across diverse ASFV isolates to ensure sensitivity and specificity, particularly considering the genetic diversity observed in non-Eurasian lineages.

What are the practical considerations for using H108R-deleted ASFV in laboratory research?

Working with H108R-deleted ASFV in laboratory settings requires specific considerations:

  • Biosafety assessment: While attenuated, ASFV-G-ΔH108R still retains residual virulence , necessitating appropriate biosafety containment (typically BSL-3 for ASFV work).

  • Genetic stability monitoring: Regular sequencing to ensure the deletion remains stable during passage, particularly for long-term studies.

  • Growth conditions optimization: Accounting for the delayed replication kinetics in experimental design, potentially extending incubation times compared to wild-type virus protocols .

  • Purification strategies: Utilizing reporter gene expression (e.g., mCherry fluorescence) for virus tracking and purification .

  • Potential for reversion assessment: Regular virulence testing to monitor for any compensatory mutations that might emerge during passage.

Researchers should also consider the potential immunological differences between wild-type and H108R-deleted viruses when designing experiments focused on host-pathogen interactions or vaccine efficacy.

How can researchers optimize protocols for producing recombinant H108R protein for functional studies?

The production of recombinant H108R protein for functional studies presents challenges due to its transmembrane domain characteristics. Researchers might consider:

  • Expression system selection:

    • Bacterial systems for non-glycosylated protein

    • Insect or mammalian cells for proteins with post-translational modifications

    • Cell-free systems for potentially toxic membrane proteins

  • Solubilization strategies:

    • Inclusion of detergents for membrane protein solubilization

    • Creation of fusion constructs (e.g., with MBP or SUMO) to enhance solubility

    • Truncation variants omitting the transmembrane domain for soluble protein studies

  • Purification approach:

    • Affinity tags positioned to avoid interference with functional domains

    • Size exclusion chromatography to ensure homogeneity

    • Detergent exchange during purification for membrane protein stability

  • Functional validation:

    • Circular dichroism to confirm proper folding

    • Thermal shift assays to optimize buffer conditions

    • Activity assays based on predicted function (e.g., binding assays if interaction partners are identified)

The transmembrane prediction for residues 6-23 should inform construct design, potentially requiring specialized membrane protein handling techniques throughout expression and purification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.