Recombinant African swine fever virus Protein H108R (Pret-129)

Basic Research Questions

• What is the structural composition of the H108R protein from ASFV?

  H108R is a small transmembrane protein with a length that varies between 108-111 amino acids across different ASFV isolates. The Pret-129 variant contains 108 amino acids with the sequence MVNLFPVFTLIVIITILITTRELSTTMLIVSLVTDYIIINTQYTEQQHENNTFSMPQKNSFSESYN KDKKSNTHIPYQWLAPELKEAESKYWWGNYDPHSEPVLAGAS. The protein features a transmembrane region between amino acids 6 and 23 in the N-terminal region . Commercial recombinant versions typically include an N-terminal 10xHis-tag to facilitate purification and detection .

• How does H108R contribute to ASFV virulence?

  H108R has been identified as a novel determinant of virulence in ASFV. Research shows that deletion of the H108R gene from virulent strains like ASFV-Georgia2007 (ASFV-G) dramatically reduces virulence in swine models. While the exact mechanism remains under investigation, animals infected with ASFV-G-ΔH108R (with H108R deleted) show significantly reduced clinical symptoms compared to those infected with the parental virus, with most animals surviving infection . This indicates that H108R plays a crucial role in the pathogenesis of ASFV infection, though it is not essential for virus replication.

• What is the genetic diversity of H108R across ASFV isolates?

  Genetic analysis of H108R across diverse ASFV isolates has revealed three main genetic groups. The length of the protein varies between 108-111 amino acids, with larger versions containing three amino acid insertions found in isolates such as Malawi Lil-20/1, Ken06.Bus, and Kenya 1950. The pandemic Eurasian lineage shows high conservation of this gene, with a unique S54F substitution observed in the Georgia 2007/1 isolate . This diversity should be considered when selecting specific variants for research applications.

Advanced Research Questions

• What are the optimal expression and purification methods for recombinant H108R protein?

  For optimal expression of recombinant H108R, an in vitro E. coli expression system is commonly employed. The full-length protein (amino acids 1-108) is typically expressed with an N-terminal 10xHis-tag to facilitate purification. After expression, the protein can be purified using affinity chromatography methods suitable for His-tagged proteins. The purified protein is usually provided in either liquid form or as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . When working with the recombinant protein, researchers should avoid repeated freeze-thaw cycles, and working aliquots should be stored at 4°C for up to one week.

• How does the expression kinetics of H108R inform experimental design for antiviral studies?

  H108R demonstrates a late expression profile during the ASFV replication cycle. Time-course experiments in primary swine macrophages infected with ASFV-G show that H108R transcription is detectable at 4 hours post-infection (hpi) and remains stable until at least 24 hpi. The expression pattern overlaps with that of the B646L gene (encoding the p72 protein), confirming its classification as a late gene . For antiviral studies, this kinetic profile suggests that compounds targeting H108R would be most effective if they can reach the viral replication sites during late stages of infection. Experimental designs should incorporate time points beyond 4 hpi to properly assess the effects on H108R expression and function.

• What methodologies should be employed to assess the impact of H108R on viral replication in vitro?

  To evaluate the impact of H108R on viral replication, researchers should use multistep growth curve analyses in primary swine macrophages, the natural target cells during ASFV infection. Cells should be infected at a low multiplicity of infection (MOI) of 0.01, and samples collected at regular intervals (e.g., 2, 24, 48, 72, and 96 hpi) to track viral growth kinetics. Virus titers can be quantified using hemadsorption assays (HAD50/mL). Comparative studies between wild-type virus and H108R-deleted mutants (such as ASFV-G-ΔH108R) have shown that although H108R is not essential for virus replication, its absence causes a significant delay (10-100 times reduction) in viral yields at 24, 48, and 72 hpi, with similar final titers achieved by 96 hpi .

• How can recombinant H108R be utilized in the development of diagnostic assays for ASFV?

  Recombinant H108R protein can serve as a valuable antigen for developing ELISA-based diagnostic assays for ASFV detection. For optimal assay development, the purified recombinant protein should be used to coat ELISA plates at standardized concentrations. Given the genetic diversity of H108R across ASFV isolates, researchers should consider using multiple variants (such as Pret-129 and Ken-129) to improve detection across different ASFV strains . When designing such assays, it's critical to validate specificity by testing against sera from pigs infected with different ASFV isolates and other related viruses to avoid cross-reactivity.

• What are the key experimental considerations when evaluating H108R-deleted ASFV variants as potential vaccine candidates?

  When evaluating H108R-deleted variants as vaccine candidates, researchers should follow a structured approach. First, assess attenuation by inoculating pigs (80-90 pounds) intramuscularly with a low dose (e.g., 10² HAD50) of the H108R-deleted variant and monitor clinical signs, body temperature, and viremia over at least 28 days. Compare these outcomes with animals inoculated with the parental virulent strain. For efficacy studies, challenge the surviving animals with the virulent parental strain and monitor for 21 days post-challenge. Key parameters to measure include: clinical signs (using a standardized scoring system), body temperature (values >104°F indicate fever), viremia levels using hemadsorption assays, and ASFV-specific antibody responses. Research has shown that animals surviving ASFV-G-ΔH108R infection develop protective immunity against challenge with virulent ASFV-G .

• How should researchers interpret heterogeneous clinical outcomes in animals inoculated with H108R-deleted ASFV variants?

  Heterogeneous clinical outcomes, as observed in studies with ASFV-G-ΔH108R, require careful interpretation. When five animals were inoculated with this variant, one developed a protracted but fatal form of ASF, while four survived the 28-day observation period with minimal clinical signs. This heterogeneity may reflect individual variation in host immune responses or subtle differences in viral replication dynamics. Researchers should collect comprehensive data on viremia profiles, which have shown that animals infected with H108R-deleted variants display delayed but persistent viremia with lower peak titers compared to those infected with virulent parental strains . Statistical analysis should account for this heterogeneity, potentially using mixed-effects models that can accommodate individual variation.

• What approaches should be used to investigate the molecular interactions of H108R within the viral particle?

  To investigate H108R's molecular interactions, researchers should employ a combination of biochemical and imaging techniques. Immunoelectron microscopy has previously localized H108R to the inner envelope of the virus particle . To identify protein-protein interactions, co-immunoprecipitation assays using antibodies against the His-tag of recombinant H108R can be performed, followed by mass spectrometry analysis of co-precipitated proteins. For structural studies, circular dichroism spectroscopy can provide information about the secondary structure of the protein, particularly important for understanding the transmembrane domain (amino acids 6-23). Additionally, yeast two-hybrid or proximity labeling methods may reveal interaction partners. Since H108R lacks homology with other known proteins (as determined by Pfam analysis) , these molecular interaction studies are essential for elucidating its precise function.