Recombinant African swine fever virus Protein H108R (Mal-125)

Shipped with Ice Packs
In Stock

Description

Functional Role in ASFV Pathogenesis

The H108R protein is critical for ASFV virulence:

  • Virulence Attenuation: Deletion of the H108R gene in the virulent ASFV-Georgia2007 strain (ASFV-G-ΔH108R) reduced mortality in pigs. Surviving animals exhibited prolonged viremia, lower viral titers, and robust antibody responses, conferring protection against parental virus challenge .

  • Transcription Timing: Expressed as a late gene (detected at 4–24 hours post-infection), overlapping with the late viral protein p72 (B646L) .

  • Evolutionary Pressures:

    • Purifying Selection: 5 codons (aa 22, 23, 28, 41, 45) under negative selection, indicating functional conservation .

    • Positive Selection: Amino acid 50 (N50M substitution) in Malawi Lil-20/1 and Ken06.Bus isolates suggests adaptive evolution .

Genetic Diversity and Evolutionary Insights

The H108R gene exhibits limited recombination and strong purifying selection, reflecting its essential role in viral fitness. A phylogenetic analysis grouped isolates into three genetic clusters:

ClusterRepresentative IsolatesKey Feature
IGeorgia 2007/1 (pandemic lineage)High conservation, S54F substitution
IILIV 5 40 (genotype I)Early lineage, ancestral variants
IIIMalawi Lil-20/1 (genotype VIII)3-aa insertion, non-pandemic

These clusters underscore the gene’s stability within the pandemic lineage while permitting adaptive mutations in non-pandemic strains .

Research Applications and Vaccine Development

The recombinant H108R protein is utilized in:

  • Diagnostic Tools: Serves as an antigen in ELISA kits for detecting ASFV-specific antibodies .

  • Vaccine Candidates:

    • Attenuated Strains: Deletion of H108R in ASFV-G-ΔH108R reduced virulence but retained immunogenicity, suggesting potential as a live-attenuated vaccine .

    • Subunit Vaccines: The protein’s role in viral structure and immune modulation makes it a candidate for recombinant vaccine approaches .

Production and Biochemical Properties

ParameterValue/DescriptionSource
Host OrganismE. coli
TagN-terminal His-tag

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
Mal-125; j5R; Protein H108R; pH108R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Target Names
Mal-125
Target Protein Sequence
MVNLFPVFTLIVIITILITTRELSTTMLIVSLVTDYIIINTQYTEQQHEMNTFSTQQLPQ KNSFNESYNKDKKSNTHIPYQWLAPELKEAENKYWWGNYDPYSEPVLAGAS
Uniprot No.

Target Background

Protein Families
Asfivirus H108R family
Subcellular Location
Virion membrane; Single-pass membrane protein.

Q&A

What is the genetic and structural characterization of the H108R protein?

The H108R gene encodes a relatively small protein ranging from 108 to 111 amino acids in length, depending on the viral strain. Structural analysis reveals a transmembrane region between amino acids 6 and 23 in the N-terminal region . The protein has been localized to the inner envelope of the virus particle . No significant homology with other proteins has been found when compared against the Pfam database of protein families, suggesting it may have a unique function . The protein's small size and transmembrane characteristics are consistent with other virulence-associated proteins found in poxviruses, such as the I5L protein .

How is H108R genetically conserved across different ASFV isolates?

The H108R gene shows distinct patterns of conservation across ASFV genotypes. Genetic analysis of nine ASFV isolates representing diverse genotypes revealed three main genetic groups . The pandemic Eurasian lineage (represented by Georgia 2007/1, genotype II) shows 100% identity among isolates within this lineage, indicating high conservation throughout the pandemic . A distinguishing feature of this lineage is the S54F substitution observed in the Georgia 2007/1 isolate . Some isolates such as Malawi Lil-20/1, Ken06.Bus, and Kenya 1950 contain three amino acid insertions resulting in a longer 111 amino acid protein .

What is the transcriptional profile of the H108R gene during viral replication?

Time course experiments in primary swine macrophages infected with ASFV-G (MOI = 1) demonstrate that H108R transcription is detected at 4 hours post-infection (hpi) and remains stable until at least 24 hpi . When compared with well-characterized ASFV proteins such as the early protein p30 (CP204L) and the late protein p72 (B646L), H108R expression overlaps with the kinetics of the B646L gene, indicating it should be classified as a late gene in the viral replication cycle . This timing suggests H108R may be involved in virus assembly or modulation of host responses later in infection.

What is the mechanism by which H108R contributes to virulence?

While the exact molecular mechanism remains to be fully elucidated, several observations provide insight into H108R's role in virulence. The protein's localization to the inner envelope of the virus particle suggests it may play a role in virus structure or assembly . Its transmembrane characteristics are similar to other small viral proteins that enhance viral replication and virulence, such as the I5L protein in poxviruses . The delayed replication in macrophages when H108R is deleted suggests it may optimize viral replication in these key immune cells . The purifying selection acting on specific amino acids points to functionally important regions that likely contribute to its virulence-enhancing properties .

How can researchers generate H108R gene deletion mutants?

Researchers can generate H108R deletion mutants through homologous recombination techniques. As demonstrated with ASFV-G-ΔH108R development, the process involves:

  • Design of a recombination cassette containing a reporter gene (e.g., mCherry under the ASFV p72 promoter) flanked by homologous regions to the target areas surrounding H108R

  • Transfection of the cassette into cells infected with the parental virus strain

  • Selection and purification of recombinant viruses through multiple limiting dilution steps (at least 16 rounds were required in the reported study) based on fluorescent reporter expression

  • Verification of genetic modifications using Next Generation Sequencing (NGS) to confirm:

    • The expected deletion (e.g., 86 nucleotide deletion from positions 155,233 to 155,318 in the H108R gene)

    • Correct insertion of the reporter cassette

    • Absence of undesired modifications in the rest of the viral genome

What protocols are most effective for assessing virulence of H108R-deleted ASFV in vivo?

For rigorous assessment of virulence attenuation, researchers should follow these methodological approaches:

  • Animal selection: Use groups of domestic swine (minimum n=5 per group) with appropriate controls

  • Inoculation method: Administer virus intramuscularly at defined doses (e.g., 10² HAD₅₀)

  • Clinical parameters to monitor:

    • Body temperature (record daily, define threshold for fever as >104°F)

    • Clinical signs (anorexia, depression, skin discoloration, diarrhea)

    • Clinical scoring system to quantify disease progression

  • Sample collection schedule:

    • Blood samples at regular intervals (e.g., days 4, 7, 11, 14, 21, 28 post-infection)

    • Terminal tissue collection including liver, spleen, and lymph nodes

  • Virological assessments:

    • Viremia quantification using hemadsorption assays (HAD₅₀/mL)

    • Viral loads in tissues

  • Immunological parameters:

    • ASFV-specific antibody responses

    • Cellular immune responses (if applicable)

The experimental timeline should extend to at least 28 days post-infection to fully capture the disease dynamics in surviving animals .

What methods should be used to evaluate protective immunity conferred by H108R-deleted viruses?

To evaluate protective immunity, researchers should implement the following protocol:

  • Initial immunization:

    • Inoculate animals with the attenuated virus (e.g., ASFV-G-ΔH108R) at an appropriate dose (e.g., 10² HAD₅₀)

    • Monitor for 28 days to confirm survival and clinical status

  • Challenge model:

    • Challenge immunized animals with virulent parental virus (e.g., ASFV-G) at a defined dose

    • Include a naive control group challenged under identical conditions

  • Post-challenge assessment:

    • Monitor clinical signs and body temperature daily

    • Record mortality rates and mean time to death

    • Collect blood samples to evaluate viremia

    • Calculate protection rates and statistical significance

  • Immunological correlates of protection:

    • Measure pre-challenge antibody titers to identify potential correlates of protection

    • Assess post-challenge immune responses

The experimental data should be presented in tables that include fever onset, duration, maximum temperature, and survival rates for both immunized and control groups .

How can the residual virulence of ASFV-G-ΔH108R be further attenuated for vaccine development?

While ASFV-G-ΔH108R shows significant attenuation compared to wild-type virus, some residual virulence remains as evidenced by one animal succumbing to a protracted form of the disease in experimental trials . Further attenuation could be achieved through:

  • Combinatorial gene deletions: Combining H108R deletion with deletion of other known virulence factors. Research indicates that H108R deletion "may be used as a tool to increase the attenuation of currently experimental vaccines to improve their safety profiles" .

  • Targeted mutations: Instead of complete deletion, introducing specific mutations in critical functional domains of H108R might reduce virulence while maintaining immunogenicity.

  • Viral vector expression systems: Using only the immunogenic components of H108R in a safer viral vector system.

  • Dose optimization: Determining the minimum effective dose that maintains protective immunity while minimizing adverse effects.

The development of optimal attenuation strategies requires comparative studies measuring the virulence and protection efficacy of various genetic modifications .

What is the significance of the heterogeneous disease outcomes observed with ASFV-G-ΔH108R infection?

In experimental infections with ASFV-G-ΔH108R, animals showed variable responses: one animal developed fatal disease (by day 9), three showed transient fever at different timepoints, and one remained completely asymptomatic . This heterogeneity presents both challenges and opportunities:

  • Research implications:

    • Need for larger sample sizes in experimental studies to account for individual variation

    • Importance of identifying host genetic or immunological factors that influence disease outcomes

    • Potential for developing biomarkers that predict which animals might develop more severe disease

  • Methodological considerations:

    • Implementation of more sensitive monitoring techniques to detect subclinical effects

    • Development of standardized clinical scoring systems that can capture subtle variations in disease presentation

    • Extended observation periods (>28 days) to fully characterize long-term outcomes and potential viral persistence

Understanding the basis of this heterogeneity could provide insights into host-pathogen interactions that determine ASFV pathogenesis .

How does the viremia pattern of ASFV-G-ΔH108R inform research on virus-host interactions?

ASFV-G-ΔH108R produces a distinctive viremia pattern that differs significantly from the parental virus. While animals infected with ASFV-G show high viremia (10⁷⁻¹⁰⁸ HAD₅₀/mL) by day 4 post-infection , ASFV-G-ΔH108R infection results in:

  • Undetectable or low viremia (≤10⁵.³ HAD₅₀/mL) at day 4 post-infection

  • Peak viremia (10⁶.³-10⁷.⁸ HAD₅₀/mL) around day 11 post-infection

  • Gradually decreasing but persistent viremia through day 28

This viremia pattern provides a valuable model for studying:

  • Viral clearance mechanisms: How the host immune system controls but fails to completely eliminate the virus

  • Immune evasion strategies: How the attenuated virus maintains persistence despite immune recognition

  • Correlates of protection: How persistent low-level replication might contribute to robust protective immunity

  • Host factors: Identification of genetic or immunological factors that influence viral control

Detailed analysis of viremia kinetics in relation to immune responses could reveal critical mechanisms of host-virus interaction and guide strategies for intervention .

What approaches could identify the precise function of H108R at the molecular level?

Current knowledge confirms H108R's role in virulence but not its exact molecular function. Future research should employ:

  • Proteomic analyses:

    • Identification of viral and cellular binding partners through techniques such as co-immunoprecipitation followed by mass spectrometry

    • Characterization of post-translational modifications that might regulate H108R function

  • Structural biology approaches:

    • Determination of H108R three-dimensional structure through X-ray crystallography or cryo-electron microscopy

    • Structure-guided mutagenesis of key amino acids identified by evolutionary analysis (particularly those under purifying selection at positions 22, 23, 28, 41, and 45)

  • Transcriptomic and functional genomic studies:

    • RNA-seq analysis comparing host cell responses to wild-type versus ΔH108R virus

    • CRISPR screens to identify host factors involved in H108R-mediated virulence

  • Cell biology techniques:

    • Live-cell imaging to track H108R localization during infection

    • Assessment of H108R's impact on cellular ultrastructure and viral factory formation

These approaches could reveal whether H108R functions in virus assembly, immune evasion, host metabolism modulation, or other processes critical for viral virulence .

How might genetic variations in H108R between ASFV genotypes correlate with differences in virulence?

The genetic analysis of H108R revealed three main genetic groups with variations in protein length and specific amino acid substitutions . Future research should:

  • Create a comprehensive database of H108R sequences from diverse ASFV isolates with well-characterized virulence phenotypes

  • Develop a standardized virulence testing platform to compare:

    • Field isolates with natural H108R variations

    • Recombinant viruses with H108R variants introduced into a common genetic background

  • Analyze specific variations:

    • Study the functional significance of the S54F substitution characteristic of the pandemic Eurasian lineage

    • Investigate the impact of the three-amino acid insertions present in some African isolates

    • Examine the N50M substitution that appears to be under positive selection

  • Correlate sequence variations with:

    • Replication efficiency in macrophages

    • Virulence in animal models

    • Geographic distribution and epidemic potential

This systematic approach could identify specific H108R motifs associated with enhanced virulence and provide targets for rational vaccine design .

What is the relationship between H108R and other ASFV virulence factors?

As research identifies multiple ASFV virulence determinants, understanding their potential interactions becomes crucial. Future studies should:

  • Create and characterize multi-gene deletion mutants:

    • Combine H108R deletion with deletion of other known virulence genes

    • Assess additive, synergistic, or antagonistic effects on attenuation and immunogenicity

  • Investigate potential functional relationships:

    • Map protein-protein interactions between H108R and other viral proteins

    • Determine if H108R affects the expression or function of other virulence factors

  • Analyze temporal and spatial co-localization:

    • Track co-localization of H108R with other viral proteins during infection

    • Determine if H108R is incorporated into specific viral substructures

  • Examine evolutionary patterns:

    • Conduct comparative evolutionary analyses across multiple virulence genes

    • Identify potential co-evolution patterns suggesting functional relationships

Understanding these relationships could provide a more comprehensive model of ASFV virulence mechanisms and guide rational attenuation strategies for vaccine development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.