Recombinant African swine fever virus Protein MGF 110-11L (Ken-020)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Ken-020; Protein MGF 110-11L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Target Names
Ken-020
Target Protein Sequence
MKVLLGLLLGYSVLILTHELPDLSATQHPPKEELAYWCTYVKNCDFCWDCQNDICKNKIT NESISINSIVNCRVTRDSIHQWCFYEISVKMPNHHNMECSLPRPYTGNEIFMEKWGGGDY WPIIIRHCCFYLVFSIAFVGYIVFAYHKNLHLNTTMKLLALLSILIWLSQPGLNRPLSIF YMKQNLPRTYTPPVRELEYWCTYGKHCHFCWECRHGICKNKVWDDMPFIKQNDYISQCSI ARYFDRCMYFIKPKTPYIHYMDCSQPTAYEGFSHS
Uniprot No.

Target Background

Function
Plays a role in viral cell tropism and may be essential for efficient viral replication within macrophages.
Protein Families
Asfivirus MGF 110 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is MGF 110-11L and what is its significance in ASFV research?

MGF 110-11L is a protein encoded by a gene belonging to the multigene family 110 (MGF 110) of African swine fever virus. It has been identified as a protein of interest in ASFV research, particularly for its potential role in virulence and as a target for vaccine development. MGF 110-11L is part of a larger family where some members have been implicated in virus-host interactions, though MGF 110-11L itself has been described as having "unique and uncharted characteristics" . The protein is produced recombinantly from E. coli for research applications, including experimental vaccine development studies . Significantly, the MGF 110-11L gene is one of the targets for deletion studies aimed at creating attenuated ASFV strains with reduced virulence that could serve as potential vaccine candidates .

How does MGF 110-11L compare to other members of the MGF 110 family?

MGF 110-11L belongs to a multigene family with several distinct members that appear to have different functions within the ASFV life cycle. According to research findings, MGF 110-1L is the only member of this family present in all ASFV isolates, yet it does not affect virulence . Other members of the family have more defined functions: MGF 110-4L and -6L localize to pre-Golgi compartments and may be involved in endoplasmic reticulum rearrangements that impair protein synthesis related to cytokine production or antigen presentation . MGF 110-7L activates the PERK/PKR-IF2a pathway, influencing host gene translation and inhibiting stress granule formation . Interestingly, MGF 110-5L-6L is not involved in clinical symptom development in swine, while deletion of MGF 110-9L from highly virulent strains results in partial attenuation . MGF 110-11L was specifically selected for deletion in vaccine development studies because of its "unique and uncharted characteristics," suggesting it may have functions distinct from other family members .

What methods are used to produce recombinant MGF 110-11L protein for research?

The production of recombinant MGF 110-11L typically employs E. coli expression systems, as evidenced by multiple research sources . The specific methodology involves:

  • Gene synthesis or amplification: The MGF 110-11L gene sequence is synthesized or amplified from ASFV genomic DNA.

  • Cloning into expression vectors: The gene is inserted into bacterial expression vectors that contain appropriate promoters for protein production in E. coli.

  • Transformation and expression: The recombinant plasmids are transformed into E. coli strains optimized for protein expression.

  • Protein purification: The expressed protein is purified using techniques such as affinity chromatography.

For the specific Ken-020 variant (from Pig/Kenya/KEN-50/1950 isolate), the recombinant protein is produced as a partial sequence, as indicated in commercial product specifications . The amino acid sequence 1-117 of the MGF 110-11L protein from the Warthog/Namibia/Wart80/1980 isolate has also been produced recombinantly in E. coli, suggesting that truncated versions of the protein may be sufficient for certain research applications .

What are the experimental methods for studying MGF 110-11L gene function in ASFV?

Researchers employ several sophisticated methods to study MGF 110-11L function:

  • CRISPR/Cas9 gene deletion: This technique has been used to selectively remove the MGF 110-11L gene from ASFV genomes. In one study, researchers deleted MGF 110-11L from the Lv17/WB/Rie1 strain using CRISPR/Cas9 methodology to evaluate the gene's role in virulence .

  • Replacement with reporter genes: The deletion method often includes replacement of the target gene with marker genes like enhanced green fluorescent protein (eGFP) to track successful recombination. For example, in the Lv17/WB/Rie1/d110-11L construct, the MGF 110-11L gene was replaced with eGFP under the control of the p72 promoter of ASFV .

  • Plasmid design and assembly: Researchers construct recombinant transfer plasmids containing homologous arms for targeted recombination. The specific methodology described in one study used the pUC19 vector as a backbone, with a recombination cassette containing left and right homologous arms of approximately 1100 bp each, the p72 promoter, and the eGFP gene .

  • In vivo virulence and efficacy testing: After generating MGF 110-11L deletion mutants, researchers test the modified viruses in pigs to assess changes in pathogenicity and potential as vaccine candidates .

What in vivo experimental models are appropriate for testing hypotheses about MGF 110-11L function?

The primary experimental model for studying MGF 110-11L function is the domestic pig (Sus scrofa domesticus), as this is the natural host for ASFV infection. Specific experimental approaches include:

  • Direct inoculation studies: Pigs are inoculated with wild-type or MGF 110-11L-deleted ASFV strains to compare pathogenicity, clinical signs, viremia, and immune responses. These studies typically include monitoring of clinical signs, body temperature, virus shedding, and development of anti-ASFV antibodies .

  • Challenge-protection studies: Animals first receive attenuated virus strains (such as MGF 110-11L deletion mutants) and are subsequently challenged with virulent ASFV strains to assess protective efficacy. One study evaluated whether deletion of MGF 110-11L from the already attenuated Lv17/WB/Rie1 strain could improve its characteristics as a live-attenuated vaccine .

  • Dose-response experiments: Different doses of MGF 110-11L-deleted viruses are administered to determine minimum infectious and protective doses. Research findings indicate that vaccine candidates with MGF 110-11L deletion "administered at high doses showed reduced pathogenicity compared to the parental strain and induced immunity in vaccinated animals" .

  • Contact transmission studies: These evaluate whether modified viruses can be transmitted between animals, an important safety consideration for live-attenuated vaccine candidates. Studies have shown that attenuated strains like Lv17/WB/Rie1 can be shed in amounts sufficient for infection of in-contact pigs .

How does deletion of MGF 110-11L contribute to ASFV attenuation for vaccine development?

The deletion of MGF 110-11L has been strategically explored as a method to attenuate ASFV strains for vaccine development purposes. The rationale and findings include:

  • Enhanced attenuation of already-attenuated strains: Researchers hypothesized that deleting MGF 110-11L from the naturally attenuated Lv17/WB/Rie1 strain could "improve the usability of the virus as a live-attenuated vaccine, reducing unwanted side effects" . This suggests that MGF 110-11L deletion might further reduce pathogenicity while maintaining immunogenicity.

  • Demonstrated reduction in pathogenicity: Experimental evidence confirms that deleting MGF 110-11L from the Lv17/WB/Rie1 genome resulted in strains with "reduced pathogenicity compared to the parental strain" . This is a critical finding as it establishes that MGF 110-11L contributes to the residual virulence of the Lv17/WB/Rie1 strain.

  • Maintenance of immunogenicity: Importantly, the MGF 110-11L-deleted viruses were still able to "induce immunity in vaccinated animals" , suggesting that the deletion does not compromise the ability of the virus to stimulate protective immune responses.

  • Balance of attenuation and efficacy: Although the MGF 110-11L deletion increased attenuation, "several mild clinical signs were observed" in vaccinated animals, indicating that the balance between safety and immunogenicity requires careful optimization.

What are the methodological approaches for evaluating MGF 110-11L-deleted ASFV as vaccine candidates?

Evaluating MGF 110-11L-deleted ASFV as vaccine candidates involves a structured approach:

  • Construction and isolation of deletion mutants: Using techniques like CRISPR/Cas9, researchers delete the MGF 110-11L gene and replace it with marker genes (e.g., eGFP). The recombinant viruses are then isolated and propagated .

  • Safety assessment: The attenuated viruses are administered to pigs at various doses to evaluate:

    • Clinical signs and body temperature

    • Viremia (presence and duration)

    • Virus shedding (quantity and duration)

    • Potential for transmission to contact animals

  • Immunogenicity evaluation: Researchers assess the immune response through:

    • Antibody titer measurements

    • Cell-mediated immune response analysis

    • Duration of immunity studies

  • Protection efficacy testing: Vaccinated animals are challenged with virulent ASFV strains to determine:

    • Prevention of clinical disease

    • Reduction in viremia and virus shedding

    • Survival rates

  • Comparative analysis: The performance of MGF 110-11L-deleted strains is compared with:

    • The parental strain (e.g., Lv17/WB/Rie1)

    • Other attenuated ASFV candidates

    • Different vaccination strategies (dose, route, schedule)

What challenges exist in developing subunit vaccines that include MGF 110-11L?

Development of subunit vaccines incorporating MGF 110-11L faces several challenges:

  • Limited knowledge of protective antigens: As noted in research, "Development of subunit vaccines is complicated by the lack of information on protective antigens as well as suitable delivery systems" . The specific contribution of MGF 110-11L to protective immunity remains incompletely characterized.

  • Variation between ASFV genotypes: Studies have shown that "results cannot necessarily be transferred between different ASFV genotypes" . This suggests that MGF 110-11L from one genotype may not confer protection against other genotypes, complicating universal vaccine development.

  • Delivery system limitations: Effective presentation of MGF 110-11L to the immune system requires appropriate delivery systems. Viral vectors like adenoviruses have been used for other ASFV antigens , but the optimal delivery system for MGF 110-11L specifically requires further investigation.

  • Combination with other antigens: Evidence suggests that protection against ASFV may require multiple antigens. Research has demonstrated that "a pool of three adenovirus vectored genotype I ASFV genes (F317L, MGF505-5R, and E199L)" provided protection against genotype I ASFV but not genotype II . Similar studies would be needed to determine whether MGF 110-11L should be included in such antigen pools.

  • Expression and purification challenges: Producing recombinant MGF 110-11L with proper folding and post-translational modifications that mimic the native viral protein presents technical challenges that may affect immunogenicity.

How does MGF 110-11L compare to other ASFV antigens used in experimental vaccines?

MGF 110-11L represents just one of many ASFV proteins being investigated for vaccine development. Comparative analysis reveals:

What methodological approaches can be used to study the interactions between MGF 110-11L and other ASFV proteins?

Investigating interactions between MGF 110-11L and other ASFV proteins requires sophisticated methodological approaches:

  • Co-immunoprecipitation assays: These can identify protein-protein interactions by using antibodies against MGF 110-11L to precipitate it along with any interacting partners from infected cell lysates. The precipitated proteins are then identified through techniques like mass spectrometry.

  • Yeast two-hybrid screening: This method can systematically test for direct interactions between MGF 110-11L and other ASFV proteins by expressing them in yeast cells with reporter gene systems that activate when protein-protein interactions occur.

  • Proximity labeling approaches: Techniques like BioID or APEX2 proximity labeling, where MGF 110-11L is fused to an enzyme that biotinylates nearby proteins, can identify proteins that are in close proximity to MGF 110-11L in the cellular context.

  • Co-localization studies: Fluorescently tagged MGF 110-11L and other ASFV proteins can be expressed in cells and observed through confocal microscopy to determine whether they localize to the same cellular compartments, suggesting potential functional interactions.

  • Functional complementation assays: These test whether the phenotype of an MGF 110-11L deletion can be rescued by other ASFV proteins, potentially revealing functional redundancies or complementation within the viral genome.

  • Protein domain mapping: Using truncated versions of MGF 110-11L (such as the commercially available amino acids 1-117 fragment ) in interaction studies can help identify specific domains responsible for protein-protein interactions.

How can structural studies of MGF 110-11L inform vaccine design?

Structural studies of MGF 110-11L can significantly advance vaccine design through several approaches:

  • Epitope mapping: Determining the three-dimensional structure of MGF 110-11L would allow identification of surface-exposed regions that might serve as B-cell epitopes. This information is critical for designing subunit vaccines that present the most immunogenic portions of the protein.

  • Structure-based antigen optimization: Knowledge of MGF 110-11L's structure could enable rational modifications to enhance stability, solubility, or immunogenicity. For example, researchers might identify flexible regions that could be stabilized to better present critical epitopes.

  • Multi-epitope vaccine constructs: Structural information could guide the design of chimeric proteins that combine the most immunogenic epitopes from MGF 110-11L with those from other ASFV proteins. This approach might be particularly valuable given that protection against ASFV often requires multiple antigens .

  • Prediction of post-translational modifications: Structural studies could reveal potential sites for post-translational modifications that might be important for immunogenicity, informing expression system selection for recombinant production.

  • Interaction with immune receptors: Understanding the structure of MGF 110-11L could help predict and potentially enhance its interaction with pattern recognition receptors or MHC molecules, potentially improving vaccine efficacy.

  • Comparison with homologous proteins: Structural comparison between MGF 110-11L variants from different ASFV isolates (such as Ken-020 versus other isolates) could identify conserved structural features that might be targets for broadly protective vaccines.

What are the current limitations in our understanding of MGF 110-11L's role in ASFV pathogenesis?

Despite progress in ASFV research, several significant knowledge gaps remain regarding MGF 110-11L:

  • Undefined molecular function: The specific biochemical or biological function of MGF 110-11L remains largely unknown, with researchers describing it as having "unique and uncharted characteristics" . Without this fundamental understanding, it is difficult to predict how targeting this protein might affect viral fitness or host responses.

  • Host cell interaction partners: The cellular proteins that interact with MGF 110-11L have not been comprehensively identified, limiting our understanding of how it might influence host cell processes during infection.

  • Role in different host species: While domestic pigs are highly susceptible to ASFV, the virus causes persistent, asymptomatic infections in its natural hosts (warthogs and bushpigs). The potential differential function of MGF 110-11L in different host species remains unexplored.

  • Temporal expression dynamics: Detailed information about when and where MGF 110-11L is expressed during the viral replication cycle is limited, making it difficult to understand its stage-specific roles.

  • Contribution to immune evasion: Unlike some other members of the MGF 110 family that have been implicated in modulating host immune responses , the specific contribution of MGF 110-11L to immune evasion strategies remains to be elucidated.

  • Structural information: The three-dimensional structure of MGF 110-11L has not been determined, limiting structure-based functional predictions and rational vaccine design approaches.

  • Variability across ASFV isolates: While recombinant versions from specific isolates like Ken-020 are available for research, comprehensive analysis of sequence and functional conservation across diverse ASFV strains is lacking.

What are the optimal expression systems for producing recombinant MGF 110-11L for research applications?

Different expression systems offer distinct advantages for producing recombinant MGF 110-11L:

  • Bacterial expression systems (E. coli):

    • Currently the most commonly used system for MGF 110-11L production

    • Advantages: High yield, relatively low cost, well-established protocols

    • Limitations: Lack of eukaryotic post-translational modifications, potential folding issues

    • Optimization strategies: Use of specialized E. coli strains designed for expression of toxic or membrane proteins; fusion tags to enhance solubility

  • Yeast expression systems (Pichia pastoris, Saccharomyces cerevisiae):

    • Advantages: Higher eukaryotic system with some post-translational modifications, higher protein yields than mammalian cells

    • Limitations: Glycosylation patterns differ from mammalian cells

    • Applications: Better for larger-scale production of MGF 110-11L with basic eukaryotic modifications

  • Insect cell expression systems (Baculovirus):

    • Advantages: Eukaryotic post-translational modifications, good for complex proteins

    • Limitations: More complex and expensive than bacterial or yeast systems

    • Applications: Production of MGF 110-11L for structural studies requiring native-like conformation

  • Mammalian cell expression systems:

    • Advantages: Most authentic post-translational modifications and protein folding

    • Limitations: Lower yields, higher cost, more complex protocols

    • Applications: Production of MGF 110-11L for functional studies where authentic structure is critical

  • Cell-free expression systems:

    • Advantages: Rapid production, can express toxic proteins

    • Limitations: Lower yield, higher cost

    • Applications: Small-scale production for initial characterization or high-throughput screening

The choice of expression system should be guided by the specific research application, with E. coli being sufficient for many basic studies, while more complex eukaryotic systems may be necessary for functional or structural analyses requiring native-like protein.

What are the methodological considerations for detecting MGF 110-11L in experimental samples?

Detection of MGF 110-11L in experimental samples presents several technical challenges that require specific methodological approaches:

  • Antibody-based detection methods:

    • Western blotting: Requires specific anti-MGF 110-11L antibodies, which may be generated using recombinant proteins like those available commercially

    • Immunofluorescence: For detection of MGF 110-11L in fixed cells or tissues

    • ELISA: For quantitative detection in liquid samples

    • Optimization considerations: Sample denaturation conditions, antibody specificity validation, blocking reagents

  • Nucleic acid-based detection:

    • qPCR: For detecting MGF 110-11L gene expression using specific primers

    • In situ hybridization: For localizing MGF 110-11L transcripts in tissues

    • Next-generation sequencing: For comprehensive analysis of MGF 110-11L variants

    • Technical considerations: Primer design to account for strain variation, RNA quality for expression analysis

  • Reporter-based detection in recombinant viruses:

    • Fluorescent protein fusion: As demonstrated in studies where MGF 110-11L was replaced with eGFP

    • Epitope tagging: Addition of small epitope tags for detection with commercial antibodies

    • Methodological considerations: Potential impact of tags on protein function, cellular localization

  • Mass spectrometry-based detection:

    • Targeted proteomics: For specific detection of MGF 110-11L peptides

    • Untargeted proteomics: For discovery of MGF 110-11L in complex samples

    • Sample preparation considerations: Enrichment strategies, digestion methods, detection sensitivity

  • Functional assays:

    • Complementation assays: Testing whether adding MGF 110-11L restores functions in deletion mutants

    • Protein-protein interaction assays: Detecting MGF 110-11L through its binding partners

    • Biological consideration: Sensitivity to the functional state of the protein

The combination of multiple detection methods provides the most robust approach for confirming the presence and quantity of MGF 110-11L in experimental samples.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.