Recombinant African swine fever virus Protein MGF 110-11L (War-022)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant ASFV Protein MGF 110-11L (War-022)

Recombinant African Swine Fever Virus (ASFV) Protein MGF 110-11L (War-022) is a protein expressed by the African swine fever virus . ASFV is a large, icosahedral DNA virus responsible for African swine fever, a highly contagious and economically significant disease affecting domestic and feral swine .

Characteristics of MGF 110-11L

  • Origin and Source The MGF 110-11L protein, specifically the War-022 variant, is derived from the African swine fever virus isolate Warthog/Namibia/Wart80/1980 . The recombinant form of this protein is produced in E. coli bacteria for research purposes .

  • Function MGF 110-11L plays a role in virus cell tropism and may be required for efficient virus replication in macrophages .

  • Role in ASFV Infection ASFV primarily infects domestic and wild swine, leading to a disease with clinical symptoms resembling classical swine fever, necessitating laboratory diagnosis for differentiation . ASFV is endemic to sub-Saharan Africa, circulating between ticks and wild pigs such as bushpigs and warthogs .

  • Relevance in Vaccine Development Recombinant MGF 110-11L protein is useful for vaccine development, but these vaccine ingredients cannot be used directly on humans or animals and are solely for research purposes . Attenuated live viruses with deleted virulence factors, including MGF 110-11L, are considered promising vaccine candidates .

MGF 110-11L in Attenuated ASFV Strains

  • Gene Deletion Studies Studies have explored the effects of deleting MGF110-9L and MGF360-9L genes from ASFV to create attenuated viruses . For example, the ASFV-ΔMGF110/360-9L virus, generated by deleting MGF110-9L and MGF360-9L, shows high attenuation in pigs and provides effective protection against parental ASFV challenge .

  • Immune Response Modulation Deletion of MGF110-9L and MGF360-9L impacts the host's immune response. ASFV-ΔMGF110/360-9L infection induces higher expression of Toll-like receptor 2 (TLR2) mRNA compared to parental ASFV .

  • NF-κB and TLR2 Signaling MGF110-9L and MGF360-9L's attenuated virulence might be mediated by increased NF-κB and TLR2 signaling . Overexpression of TLR2 inhibits ASFV replication and the expression of ASFV p72 protein, while knockdown of TLR2 has the opposite effect .

MGF 110 Family and Virulence

  • MGF 110 Family Members The MGF 110 family includes several members with varying effects on virulence. MGF 110-1L, present in all ASFV isolates, does not affect virulence .

  • Effects on Host Cell Processes MGF 110 proteins can influence host cell processes. For instance, MGF 110-4L and -6L may be involved in ER rearrangements, impairing the ER's ability to synthesize proteins involved in cytokine production or antigen presentation . MGF 110-7L activates the PERK/PKR-IF2a pathway, influencing host gene translation and inhibiting stress granule formation . Deletion of the MGF 110-9L gene from a highly virulent strain results in partial attenuation .

Research and Applications

  • Vaccine Development The MGF 110-11L protein is a target for vaccine development against African swine fever . Studies involving the deletion or modification of MGF 110 genes contribute to understanding ASFV virulence and potential vaccine strategies .

  • Innate Immune Response Research indicates that MGF110-9L is an inhibitor of type I IFN production and is involved in regulating multiple host functions, including the Toll signaling pathway and apoptosis .

  • Host-Cell Interactions MGF360-9L interacts with host proteins involved in proteasome catabolism, influencing ASFV replication .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
War-022; Protein MGF 110-11L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Target Names
War-022
Target Protein Sequence
MKVLLGLLLGYSVLILAHELPDLPRTQHPPKSELSYWCTYVPQCDFCWDCQDGICKNKIT ESRFIDSNHSIVNCRVFRDSKTQSCLYEISSKMPNHFNMECLHPRPYTGNEIFMRTWGGG DHQQLSIKQFCLYFIIGIAYTGCFVCALCKNLRLRTTMKLFILLSILVWLAQPVLNRPLS IFYTKQILPRTYTPPMRELEYWCTYGKHCDFCWDCKNGICKNKVLDDMPLIVQNDYISKC SITRFIDRCMYFIEPKIPYIHYMNCSLPTYFS
Uniprot No.

Target Background

Function
Plays a role in viral cell tropism and may be essential for efficient viral replication in macrophages.
Protein Families
Asfivirus MGF 110 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the MGF 110-11L protein and what is its role in African swine fever virus?

MGF 110-11L is a protein encoded by a gene belonging to the multigene family 110 (MGF 110) of the African swine fever virus (ASFV). The MGF 110 family consists of thirteen genes that are paralogs to each other, all transcribed exclusively on the reverse strand of the viral genome . Although the specific function of MGF 110-11L remains largely uncharacterized compared to other family members, researchers have targeted it for deletion studies due to its unique characteristics . The MGF 110 family proteins are located in the left variable region (LVR) of the ASFV genome, which shows high heterogeneity among different viral isolates . Current research suggests MGF 110-11L may be involved in virulence and host-pathogen interactions, as deletion studies have shown it can reduce pathogenicity while maintaining immunogenic properties in naturally attenuated strains .

How does MGF 110-11L differ from other members of the MGF 110 family?

MGF 110-11L possesses distinct characteristics that differentiate it from other members of the MGF 110 family. Unlike MGF 110-1L, which is present in all ASFV isolates but does not affect virulence, MGF 110-11L appears to influence pathogenicity in certain strains . This contrasts with MGF 110-4L and -6L, which are localized to pre-Golgi compartments and may influence ER rearrangements affecting cytokine production or antigen presentation . Furthermore, MGF 110-11L's deletion impacts differ from MGF 110-5L-6L, which is not involved in the development of clinical symptoms in swine, and MGF 110-7L, which activates the PERK/PKR-IF2a pathway to influence host gene translation and inhibit stress granule formation . MGF 110-11L's unique properties made it a target for deletion in the Lv17/WB/Rie1 strain, where researchers found it could reduce unwanted side effects without significantly compromising the strain's protective capacity as a potential vaccine candidate .

What is known about the genomic location and structure of the MGF 110-11L gene?

The MGF 110-11L gene is located in the left variable region (LVR) of the ASFV genome, an area characterized by high heterogeneity among different viral isolates . Like all members of the MGF 110 family, the MGF 110-11L gene is transcribed exclusively on the reverse strand of the viral genome . The LVR typically spans 8-20 kb and contains most of the multigene families (MGFs) with considerable variation in gene number across different isolates . In the case of the deletion mutant Lv17/WB/Rie1/d110-11L, researchers replaced the MGF 110-11L gene with an enhanced green fluorescent protein (eGFP) under the control of the p72 promoter of ASFV, creating a recombination cassette with homologous arms of approximately 1100 bp on each side . The gene's structural features are comparable to other MGF 110 family members, though each shows variation with numerous insertions, deletions, and in some cases, fusions between paralogs .

Why is MGF 110-11L being studied as a target for vaccine development?

MGF 110-11L has become a focus for vaccine development due to its potential role in attenuating ASFV without significantly reducing protective capacity. Researchers hypothesized that deleting this gene from naturally attenuated strains like Lv17/WB/Rie1 could improve their applicability as live-attenuated vaccines by reducing unwanted side effects . This approach draws on observations that naturally occurring attenuated strains often lack certain MGF 110 genes; for example, the Estonia 2014 strain is missing thirteen MGF 110 genes, while the OURT 88/3 strain lacks MGF 110-4L-7L and -12-13L genes . Experimental evidence suggests that removing MGF 110-11L from Lv17/WB/Rie1 results in reduced pathogenicity compared to the parental strain while maintaining its ability to induce immunity in vaccinated animals . This strategy aligns with broader research indicating that modifying MGF genes can alter virulence without compromising immunogenicity, making MGF 110-11L a promising target for developing safer ASFV vaccines .

What methodologies are most effective for studying MGF 110-11L function in vitro and in vivo?

The most effective approach for studying MGF 110-11L function combines CRISPR/Cas9-mediated gene deletion with both in vitro and in vivo assessment protocols. For in vitro studies, researchers have successfully used porcine alveolar macrophages (PAMs) as host cells, which are the natural target for ASFV replication . When generating deletion mutants, CRISPR/Cas9-mediated homologous recombination has proven effective, as demonstrated in the creation of Lv17/WB/Rie1/d110-11L . This method involves transfecting infected macrophages with a transfer plasmid containing homologous arms and gRNA plasmids targeting the MGF 110-11L region . Viral replication and gene expression can be monitored through immunofluorescent staining with anti-ASFV antibodies and quantitative PCR targeting the p72 gene . For in vivo evaluation, the gold standard involves challenging domestic pigs with the deletion mutant virus and comparing clinical outcomes, viral titers, and immune responses to those of the parental strain . Statistical analyses using tests such as the Mann-Whitney U test for viral titers and the Kruskal-Wallis test for specific infectivity provide rigorous quantitative assessment of functional differences .

How does deletion of MGF 110-11L affect viral replication compared to other MGF 110 family members?

Deletion of MGF 110-11L appears to have distinctive effects on viral replication compared to other MGF 110 family members. In the case of Lv17/WB/Rie1/d110-11L, the mutant virus showed reduced pathogenicity while maintaining its replicative capacity in host cells . This differs from deletions of MGF 110-1L, which was found to be non-essential, with the deletion mutant ASFV-G-ΔMGF110-1L demonstrating similar replication kinetics in primary swine macrophage cell cultures compared to the parental highly virulent field isolate Georgia2007 . Studies of other family members show varied effects: some members like MGF 110-4L and -6L impact cellular processes potentially affecting viral replication through ER rearrangements, while MGF 110-7L influences host translation through the PERK/PKR-IF2a pathway . Interestingly, despite these differences, variants lacking the entire MGF 110 family can still replicate ex vivo at high titers and remain virulent, suggesting these genes are not essential for basic replication processes in domestic pigs . These findings indicate that MGF 110-11L plays a specialized role distinct from other family members, potentially in modulating host responses rather than directly affecting viral replication machinery.

What are the contradictions in the literature regarding MGF 110 family functions and how should researchers interpret them?

Several notable contradictions exist in the literature regarding MGF 110 family functions, requiring careful interpretation by researchers. One significant contradiction concerns the role of MGF 110 genes in virulence: while some studies indicate that MGF 110 genes are not necessary for infectivity or virulence in pigs, other research shows that deletion of specific members like MGF 110-9L from highly virulent strains results in partial attenuation of the virus . This apparent conflict may be explained by functional redundancy within the family or strain-specific effects where the genetic background of different isolates influences the outcome of gene deletions. Another contradiction relates to naturally attenuated strains that lack MGF 110 genes, such as Estonia 2014 and OURT 88/3, suggesting these genes contribute to virulence, yet experimental deletion of some MGF 110 genes shows minimal impact on pathogenicity . Researchers should interpret these contradictions by considering the complex interactions between viral proteins, the specific genetic background of strains used in studies, and potential compensatory mechanisms that may mask gene function in deletion studies . A comparative approach analyzing multiple MGF 110 deletions across different strains, combined with systems biology approaches to identify interaction networks, would help resolve these contradictions.

What is the relationship between MGF 110-11L and host immune responses during ASFV infection?

The relationship between MGF 110-11L and host immune responses remains incompletely characterized, though emerging evidence suggests potential immunomodulatory functions. Unlike other MGF families like MGF 360/530, which are known to suppress type I interferon responses, the specific impact of MGF 110-11L on immune pathways is not well established . Studies with the deletion mutant Lv17/WB/Rie1/d110-11L indicate that removing this gene can reduce unwanted side effects while maintaining the strain's ability to induce protective immunity, suggesting MGF 110-11L may modulate aspects of the host response that contribute to pathology without being critical for immunogenicity . This parallels findings with MGF 110-9L, which when deleted from virulent strains results in partial attenuation while maintaining the ability to stimulate protective immune responses . Research on other family members indicates potential mechanisms through which MGF 110-11L might function: it could be involved in ER stress responses like MGF 110-4L and -6L, which affect cytokine production and antigen presentation, or it might influence cellular translation pathways like MGF 110-7L, which activates the PERK/PKR-IF2a pathway . Understanding these interactions requires systematic immunological assessment of MGF 110-11L deletion mutants, including analysis of cytokine profiles, antigen presentation efficiency, and adaptive immune responses.

How can researchers effectively design CRISPR/Cas9 deletion mutants targeting MGF 110-11L?

Designing effective CRISPR/Cas9 deletion mutants targeting MGF 110-11L requires careful consideration of several key factors. First, researchers should conduct comprehensive sequence analysis of the target strain to identify the precise genomic location and flanking regions of the MGF 110-11L gene, which is essential for designing specific gRNAs and homology arms . Based on successful approaches, the optimal design includes constructing a transfer plasmid containing homologous arms of approximately 1100 bp flanking each side of the MGF 110-11L gene, as demonstrated in the development of Lv17/WB/Rie1/d110-11L . Researchers should incorporate a reporter gene, such as enhanced green fluorescent protein (eGFP) under the control of a strong viral promoter like p72, to facilitate identification and isolation of recombinant viruses . For the CRISPR component, designing at least two gRNAs targeting sequences near the gene boundaries increases editing efficiency, while avoiding sequences with potential off-target effects in both the viral and host genomes . The delivery method should be optimized for the cell type used; for example, when using porcine alveolar macrophages, transfection with Fugene HD has proven effective at a ratio of 10 μL reagent to 1.5 μg transfer plasmid and 0.75 μL of each gRNA plasmid .

What cell culture systems are optimal for isolating and characterizing MGF 110-11L mutants?

Porcine alveolar macrophages (PAMs) represent the gold standard cell culture system for isolating and characterizing MGF 110-11L mutants, as they are the natural host cells for ASFV replication and provide the most physiologically relevant environment . When establishing PAM cultures, freshly harvested cells from specific-pathogen-free pigs yield optimal results, though commercial cell lines derived from PAMs can serve as alternatives when primary cells are unavailable . For successful isolation of mutants, a limiting dilution approach in 96-well plates enables identification of single plaques, which can then be screened for the presence of reporter genes (such as eGFP) using fluorescence microscopy . Immunofluorescent staining with swine anti-ASFV polyclonal antibodies at approximately 5000× dilution, visualized with labeled secondary antibodies (e.g., CF568-labeled anti-swine antibodies at 1000× dilution), provides effective confirmation of viral infection . Quantitative assessment of viral replication should include qPCR targeting conserved viral genes like p72, using primers such as F2: 5′-TACGTTGCGTCCGTGATAGG-3′ and R2: 5′-AGTTCGGATGTCACAACGCT-3′, with thermal cycling parameters including a 5-minute pre-denaturation at 95°C followed by 35 cycles of 30-second steps at 95°C, 62°C, and 72°C . Whole genome sequencing using next-generation platforms should be employed to confirm the deletion and check for unintended mutations elsewhere in the genome .

What are the most important parameters to monitor in animal studies evaluating MGF 110-11L deleted viruses?

When conducting animal studies to evaluate MGF 110-11L deleted viruses, several critical parameters must be systematically monitored. First, clinical assessment should include daily recording of rectal temperature, food intake, activity level, and specific disease signs such as cyanosis in the ears, swelling joints, and mobility issues . A standardized scoring system, such as the welfare indicators described in Directive 2010/63/EU, should be implemented to objectively quantify disease severity and establish humane endpoints . Virological parameters should include quantification of viremia using qPCR targeting the p72 gene, with samples collected at regular intervals (e.g., days 0, 3, 6, 10, 14, 21 post-infection) to establish viral kinetics . Immunological assessment should measure both humoral immunity through anti-ASFV antibody titers and cell-mediated responses through techniques such as ELISpot or flow cytometry to quantify virus-specific T cells . For challenge studies, animals should be acclimated for approximately seven days, grouped in separate stalls (with at least 5 animals per treatment group and 3 for controls), and administered precisely quantified viral doses (e.g., 10² FFU/2 mL) via the intramuscular route, preferably in the neck muscles . Post-challenge evaluation should continue for at least 21 days, with comprehensive post-mortem examination and tissue sampling of key organs including spleen, lymph nodes, and lungs to assess viral distribution and pathological changes .

How should researchers quantify and characterize MGF 110-11L protein expression in infected cells?

Quantifying and characterizing MGF 110-11L protein expression in infected cells requires a multi-faceted approach combining molecular and immunological techniques. Western blot analysis using specific antibodies against MGF 110-11L provides the most direct method for protein quantification, though this requires either generating custom antibodies or using epitope-tagged recombinant viruses given the limited commercial availability of MGF 110-11L antibodies . For temporal expression patterns, researchers should conduct time-course experiments collecting samples at early (2-4 hours), intermediate (8-12 hours), and late (18-24 hours) time points post-infection . Subcellular localization is best determined through immunofluorescence microscopy with co-staining for organelle markers such as calnexin (ER), GM130 (Golgi), or LAMP1 (lysosomes), given that other MGF 110 family members like MGF 110-4L and -6L localize to pre-Golgi compartments . For absolute quantification, mass spectrometry-based proteomics provides the most accurate measurement, particularly using stable isotope labeling approaches with multiple reaction monitoring (MRM) for targeted quantification . To assess protein-protein interactions, proximity ligation assays or co-immunoprecipitation followed by mass spectrometry can identify viral and cellular binding partners, potentially revealing functional mechanisms . RNA sequencing of infected cells, comparing wild-type virus with MGF 110-11L deletion mutants, can additionally help characterize the impact of this protein on host gene expression patterns .

How should researchers interpret differences in virulence between MGF 110-11L deletion mutants and parental strains?

Interpreting differences in virulence between MGF 110-11L deletion mutants and parental strains requires careful analysis across multiple parameters. Researchers should first establish clear quantitative metrics for virulence, including clinical scores, viral loads in blood and tissues, fever duration and intensity, and mortality rates . Statistical analysis should employ appropriate non-parametric tests such as the Mann-Whitney U test for comparing viral titers between groups, given the typically non-normal distribution of such data . When evaluating attenuated phenotypes, researchers must distinguish between reduction in overt clinical signs and changes in viral replication kinetics, as these don't always correlate directly; for example, the Lv17/WB/Rie1/d110-11L mutant showed reduced pathogenicity while maintaining sufficient replication to induce protective immunity . Context is crucial—differences in virulence should be interpreted relative to the parental strain's characteristics; deletion from a naturally attenuated strain like Lv17/WB/Rie1 may show more subtle effects than deletion from a highly virulent strain . Researchers should also consider potential compensatory mechanisms within the viral genome that might mask phenotypic effects, particularly given the functional redundancy suggested within MGF families . Finally, comprehensive analysis should include assessment of both acute phase responses and long-term outcomes, as some effects on virulence may only become apparent during specific stages of infection or under particular challenge conditions .

What statistical approaches are most appropriate for analyzing in vivo protection studies with MGF 110-11L mutants?

When analyzing in vivo protection studies with MGF 110-11L mutants, researchers should implement a comprehensive statistical framework tailored to the specific outcomes being measured. For survival data, Kaplan-Meier analysis with log-rank tests provides the most appropriate method for comparing protection rates between vaccinated and control groups, while Fisher's exact test is suitable for analyzing the final protection rates when group sizes are relatively small (n < 30 animals per group) . For continuous variables such as clinical scores, viremia levels, and body temperature, mixed-effects models accounting for repeated measures should be employed to handle the longitudinal nature of these data and account for individual variation between animals . Non-parametric tests like the Mann-Whitney U test for comparing viral titers and the Kruskal-Wallis test for analyzing specific infectivity are appropriate when data do not meet normality assumptions, which is common with biological measurements . Researchers should establish a priori significance thresholds (typically p < 0.05) and calculate appropriate sample sizes based on power analysis to ensure statistical validity . Correlation analyses between protective efficacy and immunological parameters (antibody titers, T-cell responses) can identify potential correlates of protection, helping elucidate the mechanisms underlying MGF 110-11L's role in virulence and immunity . Multiple comparison corrections (e.g., Bonferroni or false discovery rate) should be applied when numerous parameters are analyzed simultaneously to control for type I errors .

How can researchers reconcile contradictory findings about MGF 110-11L function across different ASFV strains?

Reconciling contradictory findings about MGF 110-11L function across different ASFV strains requires systematic comparative analysis and consideration of strain-specific genetic contexts. Researchers should conduct detailed genomic comparison of the strains used in different studies, focusing not only on the MGF 110-11L sequence itself but also on other genomic regions that might interact with or compensate for MGF 110-11L function . Experimental approaches should include creating parallel deletions in multiple strain backgrounds and testing them under identical conditions to directly compare functional effects . Meta-analysis of published studies using standardized effect size measures can help quantify the degree of variability across reports and identify patterns associated with specific strain characteristics or experimental conditions . Analysis of epistatic interactions through the creation of double or triple deletion mutants (combining MGF 110-11L deletion with other genes) can reveal functional relationships that explain strain-specific differences . Researchers should also consider the evolutionary context—comparing MGF 110-11L across a phylogenetic spectrum of ASFV isolates can identify conserved versus variable regions and correlate sequence variations with functional differences . Transcriptomic and proteomic analysis of host responses to different MGF 110-11L deletion mutants can identify strain-specific pathways affected by the deletion, potentially explaining phenotypic variations . Finally, integrating these datasets using systems biology approaches can help construct comprehensive models of MGF 110-11L function that account for strain-specific contexts.

What are the key considerations when evaluating the potential of MGF 110-11L mutants as vaccine candidates?

Evaluating MGF 110-11L mutants as vaccine candidates requires comprehensive assessment across multiple critical dimensions. Safety profile analysis must be rigorous, documenting all clinical signs, including mild symptoms like cyanosis in the ears and swelling joints, as observed with Lv17/WB/Rie1/d110-11L, which showed reduced pathogenicity compared to the parental strain but still induced some clinical manifestations . Protective efficacy should be quantified against challenge with virulent ASFV strains, ideally representing diverse genotypes to assess cross-protection potential, with success measured by prevention of mortality, reduction in clinical signs, and limitation of viremia . Immunological evaluation should characterize both humoral immunity (antibody titers and neutralizing capacity) and cell-mediated responses (virus-specific T cells), identifying correlates of protection that explain the vaccine's mechanism . Genetic stability assessment through multiple passages in vitro and in vivo is essential, as vaccine reversion or compensatory mutations could compromise safety or efficacy . Comparative advantage analysis should explicitly contrast MGF 110-11L deletion mutants with other vaccine approaches, including different gene deletions, to identify the optimal candidate . Researchers must also evaluate dose-response relationships to establish minimum effective doses and assess shedding patterns to determine transmission risk to unvaccinated animals . Finally, practical considerations including ease of production, stability, and delivery methods must be considered for successful translation from laboratory to field applications .

What are the most promising approaches for further characterizing the molecular function of MGF 110-11L?

Several advanced approaches hold significant promise for elucidating the molecular function of MGF 110-11L. Proximity-dependent biotinylation (BioID or TurboID) coupled with mass spectrometry represents a powerful strategy to identify the protein interaction network of MGF 110-11L in living cells, potentially revealing its cellular partners and pathways . CRISPR interference or activation (CRISPRi/CRISPRa) systems targeting host genes could be employed in a genome-wide screen to identify cellular factors that synthetic lethal or rescue phenotypes associated with MGF 110-11L deletion, uncovering functional dependencies . Cryo-electron microscopy of purified MGF 110-11L alone or in complex with binding partners would reveal structural insights that could explain functional mechanisms and guide rational protein engineering . Temporal transcriptomics and proteomics comparing wild-type and MGF 110-11L deletion mutants across multiple time points post-infection would create a dynamic picture of how this protein influences cellular processes throughout the viral life cycle . Domain mapping through systematic mutational analysis of MGF 110-11L could identify functional motifs responsible for specific activities, potentially revealing shared mechanisms with other MGF 110 family members . Advanced imaging techniques such as live-cell confocal microscopy with fluorescently tagged MGF 110-11L would track its localization and dynamics during infection, while super-resolution microscopy could reveal nanoscale details of its distribution within specific cellular compartments . Integration of these approaches through systems biology modeling would synthesize findings into a comprehensive understanding of MGF 110-11L's role in ASFV biology.

How might combination deletions involving MGF 110-11L and other viral genes enhance vaccine development?

Combination deletions involving MGF 110-11L and other viral genes offer promising avenues for enhanced vaccine development through synergistic attenuation and improved immunogenicity. Strategic deletion pairs might include MGF 110-11L with members of the MGF 360/530 families, which are known to suppress type I interferon responses, potentially creating mutants with optimized attenuation profiles that maintain robust immunogenicity . Combining MGF 110-11L deletion with modifications to structural proteins like p72 or membrane proteins such as CD2v (encoded by EP402R) could generate viruses with altered tissue tropism or enhanced presentation of protective antigens . Another approach would target MGF 110-11L alongside genes involved in immune evasion, such as A238L (an NFκB inhibitor) or DP96R (an interferon inhibitor), to create strains that better stimulate host immunity while reducing pathogenicity . Researchers could also explore sequential modification strategies, starting with naturally attenuated strains like Lv17/WB/Rie1 that already contain mutations (such as the frameshift in EP402R) and introducing MGF 110-11L deletion as a secondary modification . Systematic screening of combination deletions through high-throughput approaches would identify unexpected synergies, while rational design based on known protein interactions could target specific pathogenic mechanisms . The ultimate goal would be developing strains with precisely calibrated virulence—attenuated enough to be safe yet sufficiently replication-competent to induce robust protective immunity against heterologous challenge .

What novel delivery systems could improve the efficacy of MGF 110-11L mutant vaccines?

Innovative delivery systems could substantially enhance the efficacy of MGF 110-11L mutant vaccines through improved stability, targeted distribution, and optimized immune stimulation. Nanoparticle-based delivery platforms encapsulating attenuated MGF 110-11L deletion mutants could protect the virus from environmental degradation while facilitating targeted delivery to antigen-presenting cells, potentially reducing the required dose and enhancing safety margins . Controlled-release formulations using biodegradable polymers might provide sustained antigen exposure, mimicking the natural infection course while eliminating risks associated with viral replication . For wildlife vaccination, particularly in wild boar populations that serve as ASFV reservoirs, oral bait vaccines incorporating MGF 110-11L mutants in heat-stable, palatable formulations could enable wide-scale distribution in natural habitats . Prime-boost strategies combining MGF 110-11L deletion mutants with subunit or vectored vaccines expressing key ASFV antigens might enhance both breadth and durability of immune protection . Advanced adjuvant systems, such as those incorporating toll-like receptor agonists or cytokine-expressing constructs, could be co-delivered with MGF 110-11L mutants to shape immune responses toward protective rather than pathogenic pathways . Mucosal delivery systems targeting respiratory or gastrointestinal surfaces might induce localized immunity at natural infection sites, potentially providing sterilizing immunity that prevents initial viral establishment . Finally, temperature-stable lyophilized formulations would address crucial cold-chain challenges in regions where ASFV is endemic but refrigeration infrastructure is limited .

How can systems biology approaches enhance our understanding of MGF 110-11L's role in ASFV pathogenesis?

Systems biology approaches offer powerful frameworks for comprehensively understanding MGF 110-11L's role in ASFV pathogenesis through integration of multi-omics data and computational modeling. Network analysis integrating transcriptomics, proteomics, and metabolomics data from cells infected with wild-type versus MGF 110-11L deletion mutants can reveal emergent properties and identify key nodes where this protein influences cellular pathways . Dynamic modeling using ordinary differential equations could capture temporal aspects of MGF 110-11L's function throughout the viral life cycle, predicting how its deletion alters infection kinetics under various conditions . Machine learning approaches applied to large datasets spanning multiple ASFV strains, deletion mutants, and host responses could identify patterns and correlations not apparent through traditional analysis, potentially discovering unexpected functional relationships . Multi-scale modeling connecting molecular interactions to cellular behaviors and ultimately to tissue-level pathology could bridge the gap between MGF 110-11L's molecular function and its impact on disease progression . Comparative systems analysis across different MGF 110 family deletions would highlight common and distinct pathways affected by various members, placing MGF 110-11L within the functional landscape of this gene family . Perturbation biology approaches systematically combining MGF 110-11L deletion with drugs targeting specific host pathways could map functional dependencies and potential therapeutic synergies . Integration of these diverse datasets through advanced visualization tools and computational frameworks would transform our understanding from isolated observations to comprehensive models of how MGF 110-11L contributes to the complex virus-host interactions underlying ASFV pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.