Recombinant African swine fever virus Protein MGF 110-12L (Ken-021)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ken-021; Protein MGF 110-12L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Target Names
Ken-021
Target Protein Sequence
MKVFLGLLLGFSIILILTYQSPTTQHPPKEELAYWCTYAKSCDFCWDCQNDTCINKVINE SISITSIVNCRVTRDSQSCFYDISVKIPNHHSMECSYPRLYEHEMFMEKWRDEYWPIIIK QCCFYLVFSFAFAGCVAFAICKNLRLRTTIKLLILLSILVWLSQPILNN
Uniprot No.

Target Background

Function

Plays a role in virus cell tropism and may be essential for efficient virus replication in macrophages.

Protein Families
Asfivirus MGF 110 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the origin and basic characterization of ASFV MGF 110-12L (Ken-021)?

MGF 110-12L (Ken-021) is a protein derived from African swine fever virus isolate Pig/Kenya/KEN-50/1950, belonging to the Asfarviridae family. This virus is endemic to sub-Saharan Africa, where it maintains a natural cycle of infection between ticks and wild suids (including warthogs and bushpigs) . The recombinant version is typically produced in E. coli expression systems and carries the UniProt ID P0C9J8. The protein belongs to the multigene family 110 (MGF 110), one of several multigene families in the ASFV genome that have been implicated in host range specificity and immune evasion mechanisms.

How does MGF 110-12L fit within the broader context of ASFV multigene families?

ASFV contains four major multigene family (MGF) groups: MGF 100, MGF 110, MGF 360, and MGF 505. These families collectively play crucial roles in regulating host immune responses and determining host specificity . MGF 110-12L is one member of the MGF 110 family, which typically contains multiple members (13 members identified in some strains) . The MGF proteins are predominantly located in the terminal variable regions of the ASFV genome and show considerable variation between different ASFV isolates. Genomic analyses have shown that some ASFV strains may lack certain MGF 110 members (including MGF 110-4L, MGF 110-7L, MGF 110-8L, and MGF 110-9L), suggesting evolutionary adaptations or functional redundancy .

What is the infection cycle of ASFV and how does this relate to studying MGF 110-12L function?

The ASFV infection cycle typically spans 18-22 hours, although virion production in porcine alveolar macrophage (PAM) cells often peaks around 72 hours post-infection . This extended timeline is due to the relatively low initial infection efficiency (approximately 20% of PAM cells become infected initially, even with high viral titers) . When studying MGF 110-12L function, researchers must account for this infection kinetics to properly determine protein expression timing, localization, and interactions with host factors. Time-course experiments should be designed to capture early (4-8 hpi), middle (12 hpi), and late (18-20 hpi) stages of viral replication to fully characterize MGF 110-12L activity during infection.

What methodologies are used to study the function of MGF 110-12L in ASFV pathogenesis?

Researchers employ several complementary approaches to investigate MGF 110-12L function:

  • Gene deletion studies: Creating MGF 110-12L deletion mutants via homologous recombination, followed by phenotypic characterization both in vitro and in vivo .

  • Recombinant protein expression: Generating purified recombinant MGF 110-12L for biochemical analyses, protein interaction studies, and structural determination.

  • Transcriptomics and proteomics: Analyzing host cell responses to wild-type versus MGF 110-12L-deleted viruses to identify pathways affected by this protein.

  • Immunological assays: Evaluating effects on type I interferon responses, cytokine production, and immune cell activation.

  • Next-generation sequencing (NGS): Confirming genetic modifications in deletion mutants and comparing genome sequences between different ASFV isolates to understand evolutionary conservation .

The methodological approach for generating deletion mutants typically involves:

  • Constructing a recombination transfer vector containing flanking genomic regions

  • Creating a fluorescent reporter gene cassette (e.g., mCherry under the control of the p72 promoter)

  • Infecting macrophage cultures with wild-type virus and transfecting with the recombination vector

  • Purifying mutant viruses through limiting dilution purification

  • Confirming modifications through full-genome NGS sequencing

How does MGF 110-12L compare functionally with other MGF proteins in immune evasion?

While specific functional data for MGF 110-12L is limited in the provided search results, comparative analysis with other MGF proteins provides insights into potential mechanisms. For example, MGF-360-10L (another ASFV MGF protein) functions as a virulence factor by:

  • Targeting JAK1 and mediating its degradation in a dose-dependent manner

  • Mediating K48-linked ubiquitination of JAK1 at lysine residues 245 and 269

  • Recruiting E3 ubiquitin ligase HERC5

  • Inhibiting STAT1/2 signaling pathway and downstream interferon-stimulated genes (ISGs)

These mechanisms allow ASFV to evade host innate immune responses. While MGF 110-12L may employ different molecular mechanisms, other MGF 110 family members likely participate in complementary immune evasion strategies. Research comparing wild-type and MGF-deletion mutants has demonstrated that different MGF proteins contribute to virulence to varying degrees, with some being critical for pathogenesis and others being dispensable .

What is known about the essentiality of MGF 110-12L for ASFV replication and virulence?

Studies of MGF gene deletion mutants provide insights into their essentiality. While specific data for MGF 110-12L essentiality is not directly provided in the search results, research on the related MGF 110-1L shows that it is non-essential for virus replication. ASFV-G-ΔMGF110-1L (with MGF 110-1L deleted) demonstrated similar replication kinetics in primary swine macrophage cell cultures compared to the parental strain . Furthermore, experimental infection of domestic pigs with this deletion mutant produced clinical disease similar to the parental virus, indicating that MGF 110-1L deletion does not affect viral virulence .

The essentiality of MGF genes varies between family members. The table below summarizes in vitro and in vivo findings for different MGF gene deletions:

VirusGenes deletedGrowth in vitro compared to wild typeIn vivo effectsProtection
ΔMGFMGF360: 10L, 11L, 12L, 13L, 14L; MGF505: 1R, 2R, 3R; MGF360-9L and MGF505-4R interruptedReducedAttenuatedYes
ΔMGF360-12L/K145RMGF360-12L, K145RReducedAttenuatedPartial
ΔMGF360-12L, 13L, 14L/K145RMGF360-12L, 13L, 14L, K145RReducedAttenuatedHigher

This comparative data suggests that while individual MGF proteins might be dispensable, combinations of deletions can substantially affect viral replication and virulence .

How should researchers design experiments to evaluate MGF 110-12L immunomodulatory functions?

When investigating MGF 110-12L immunomodulatory functions, researchers should implement a multi-layered experimental approach:

  • Recombinant protein studies:

    • Express and purify MGF 110-12L in prokaryotic (E. coli) or eukaryotic systems

    • Perform protein-protein interaction studies (co-immunoprecipitation, yeast two-hybrid, or proximity labeling)

    • Assess direct effects on purified immune signaling components in cell-free systems

  • Cell culture experiments:

    • Transfect cells with MGF 110-12L expression constructs and stimulate with immune activators (IFNs, PAMPs)

    • Monitor changes in signaling cascades (phosphorylation of STATs, IRFs, etc.)

    • Measure expression of downstream ISGs via qRT-PCR and Western blotting

    • Compare responses in relevant cell types (PAMs, monocytes, dendritic cells)

  • Virus infection studies:

    • Generate MGF 110-12L deletion mutants via homologous recombination

    • Perform infection time-course experiments (4, 8, 12, 20 hpi)

    • Compare wild-type and mutant virus effects on immune pathway activation

    • Measure viral replication efficiency in different cell types

  • Transcriptome/proteome analysis:

    • Perform RNA-seq on cells infected with wild-type versus ΔMGF 110-12L virus

    • Conduct proteomics to identify changes in protein abundance and post-translational modifications

    • Use pathway enrichment analysis to identify affected cellular processes

When designing these experiments, it's important to account for the ASFV infection cycle length (18-22 hours) and the typically low infection efficiency in PAM cells (approximately 20% at 20 hpi) .

What approaches are used to generate MGF 110-12L deletion mutants for functional studies?

The generation of MGF deletion mutants follows a systematic process that has been well-established for ASFV research. Based on the methodology used for MGF 110-1L deletion , the process typically involves:

  • Construct design:

    • Identify the precise genomic location of the MGF 110-12L gene

    • Design a recombination transfer vector containing genomic flanking regions (typically 1000bp each)

    • Include a reporter gene cassette (e.g., mCherry under p72 promoter control)

  • Homologous recombination:

    • Infect macrophage cell cultures with parental ASFV

    • Transfect infected cells with the recombination transfer vector

    • Allow homologous recombination to occur, replacing the target gene with the reporter cassette

  • Purification:

    • Perform successive rounds of limiting dilution purification

    • Select for cells showing reporter gene expression (e.g., mCherry fluorescence)

    • Use the highest dilution with detectable reporter expression

  • Verification:

    • Extract viral DNA from infected cells

    • Perform full-length sequencing using next-generation sequencing

    • Confirm the expected deletion and insertion of the reporter cassette

    • Verify the absence of other mutations or contamination with parental virus

  • Amplification:

    • Scale up the purified virus in primary swine macrophage cell cultures

    • Generate virus stocks for subsequent experiments

This methodology has been successfully applied to generate ASFV deletion mutants, such as ASFV-G-ΔMGF110-1L, which contained a 645-nucleotide deletion (between positions 7004-7648) substituted with a 1226-bp cassette containing the p72mCherry construct .

What analytical techniques should be used to assess the impact of MGF 110-12L on host immune responses?

To comprehensively assess MGF 110-12L's impact on host immune responses, researchers should employ multiple analytical techniques:

  • Quantitative gene expression analysis:

    • qRT-PCR to measure expression of key ISGs (ISG15, ISG56, MX1) following infection

    • NanoString or targeted RNA-seq panels for broader immune gene profiling

    • Single-cell RNA-seq to capture cellular heterogeneity in responses

  • Protein expression and modification analysis:

    • Western blotting for total and phosphorylated forms of immune signaling proteins

    • Immunoprecipitation to detect protein complexes and interactions

    • Mass spectrometry to identify post-translational modifications and binding partners

  • Functional immune assays:

    • Type I IFN bioassays to measure functional interferon production

    • Viral replication assays (HAD50) to quantify virus production

    • Cytokine/chemokine profiling using multiplex assays (Luminex, MSD)

  • Imaging techniques:

    • Confocal microscopy to determine subcellular localization of MGF 110-12L

    • Live-cell imaging to track protein dynamics during infection

    • Proximity ligation assays to detect protein-protein interactions in situ

  • Biochemical assays:

    • Ubiquitination assays to assess protein degradation pathways

    • Chromatin immunoprecipitation to examine effects on transcription factor binding

    • EMSA or DNA-protein binding assays to assess effects on transcriptional regulation

When studying STAT1/2 signaling pathway inhibition, researchers should examine both phosphorylation status of STAT proteins and downstream ISG expression (ISG15, ISG56) following IFN-β treatment, similar to approaches used for studying MGF-360-10L .

How do different ASFV strains and isolates vary in their MGF 110 gene repertoire?

ASFV isolates show considerable variation in their MGF gene composition. Genomic analyses reveal that:

  • Some strains lack specific MGF 110 members that are present in others:

    • The Uvira B53 strain is missing MGF 110-4L, MGF 110-7L, MGF 110-8L, and MGF 110-9L compared to reference strains

    • Conversely, MGF 110-5L is present in Uvira B53 and Ken05/Tk1 but missing in Kenya 1950

  • These variations extend to other MGF families:

    • Uvira B53 lacks one MGF 100 member (MGF 100-1R)

    • Three members of MGF 360 show variations between strains

  • The total number of MGF 110 members can vary between strains, with some isolates containing up to 13 members

This genetic diversity suggests that MGF genes likely evolved to adapt to different host environments or immune pressures. When studying MGF 110-12L specifically, researchers must account for strain-specific variations that might affect experimental outcomes or interpretation of results across different studies.

How does the function of MGF 110-12L compare with other viral immune evasion proteins?

While specific functional data for MGF 110-12L is limited in the provided search results, comparing it with other viral immune evasion proteins provides a framework for understanding potential mechanisms:

  • Within ASFV:

    • MGF-360-10L targets JAK1 for degradation, recruiting E3 ubiquitin ligase HERC5 and promoting K48-linked ubiquitination of JAK1

    • This inhibits STAT1/2 signaling and downstream ISG expression (ISG15, ISG56, MX1)

    • Other MGF proteins likely target different components of innate immune pathways

  • Compared to other DNA viruses:

    • Herpesviruses encode multiple immune evasion proteins targeting similar pathways

    • Poxviruses produce soluble cytokine receptors and inhibitors of intracellular signaling

    • The mechanisms employed by MGF proteins may represent convergent evolution toward similar immune evasion strategies

  • Functional redundancy:

    • The presence of multiple MGF family members suggests redundancy in immune evasion

    • This is supported by observations that individual MGF deletion mutants often retain virulence

    • Combinations of MGF deletions show more pronounced attenuation

Research on MGF-360-10L demonstrates that ASFV employs sophisticated mechanisms to target host immune responses at multiple levels. MGF 110-12L likely contributes to this multi-layered immune evasion strategy, potentially targeting different components of antiviral pathways.

What insights can be gained from studying MGF 110-12L for ASFV vaccine development?

Studying MGF 110-12L provides several valuable insights for ASFV vaccine development:

  • Attenuation strategies:

    • Understanding which MGF proteins contribute to virulence can guide rational attenuation approaches

    • Combination deletions of MGF genes have shown promise in creating attenuated strains

    • Table data shows that deletion of MGF360 genes (including MGF360-12L) combined with K145R affects virus growth in vitro and attenuation in vivo

  • Immune response modulation:

    • Characterizing how MGF 110-12L modulates host immunity helps identify correlates of protection

    • Removal of immune evasion proteins may enhance vaccine immunogenicity

    • Understanding the specific pathways targeted by MGF 110-12L could reveal important protective mechanisms

  • Safety considerations:

    • Knowledge about gene essentiality helps predict stability of attenuated strains

    • Non-essential genes like MGF 110-1L provide potential targets for deletion without compromising virus replication

    • Comparative analyses of naturally occurring MGF variations inform evolutionary stability of attenuated strains

  • Cross-protection potential:

    • Understanding MGF diversity across ASFV strains helps predict cross-protection

    • Identifying conserved epitopes within MGF proteins could guide subunit vaccine design

    • The role of MGF-specific immune responses in protection remains to be fully characterized

Research on MGF deletion mutants has shown varying levels of protection against challenge. For example, deletion of MGF360-12L combined with K145R provided partial protection, while additional deletion of MGF360-13L and 14L increased protection levels . These findings highlight the importance of understanding MGF functions for rational vaccine design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.