Recombinant African swine fever virus Protein MGF 110-9L (War-019)

Shipped with Ice Packs
In Stock
Cat. No.
BT2498816
Source
in vitro E.coli expression system
Synonyms
War-019; Protein MGF 110-9L
Quick Inquiry

Description

Introduction to African Swine Fever Virus (ASFV) and MGF 110-9L

African Swine Fever Virus (ASFV) is a large, icosahedral DNA virus that causes African Swine Fever (ASF), a highly contagious and often lethal disease affecting domestic and wild pigs. This disease poses a significant threat to the global swine industry due to its high mortality rate and lack of effective vaccines or treatments. The ASFV genome contains multiple multigene families (MGFs), which play crucial roles in viral replication, virulence, and host interaction. Among these, the MGF 110 family, particularly the MGF 110-9L gene, has been identified as a virulence factor involved in modulating the host immune response.

Understanding MGF 110-9L

The MGF 110-9L gene is part of the ASFV MGF 110 family, located at the left end of the ASFV genome. It encodes a protein with a hydrophobic NH2-terminal sequence and a conserved cysteine-rich domain, which may be involved in viral morphogenesis and host range determination . The deletion of MGF 110-9L from ASFV results in a partially attenuated virus, which can induce a strong virus-specific antibody response in pigs and enhance their survival rates compared to the parental virus .

Role of MGF 110-9L in Virulence and Immune Response

MGF 110-9L is known to inhibit type I interferon (IFN) production, which is crucial for the host's innate immune response against viral infections . The deletion of this gene enhances type I IFN production, potentially contributing to the attenuation of the virus . Additionally, MGF 110-9L may regulate multiple host functions, including the Toll signaling pathway and apoptosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
War-019; Protein MGF 110-9L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Target Names
War-019
Target Protein Sequence
MKVIVLLLVLAVMQPVIQSQPFPGTEELPMTRRPPKKELEYWCTYAKSCDFCWNCRHGVC KNKVFEKHPLIKKNDYIQICRVSRYNDRCSYFTDSRIRRFHIMSCTNPTYYDWFDELMQV KEDRVIDVENIKHTCLCMIATIALIGYIRKQYSRMQLQAATRLLIFLGLYVLLGILMTNI IMNLPLSTDNPMQMRRPPERDLKFWCTYAKHCDFCWTCKDGMCKNKVFSDHPIITQNDYI VNCTVSRWHDRCMYEAHFRIHYQHNMNCSQPKDLEWFIELKRHLINQDDL
Uniprot No.
P0C9I9

Target Background

Function
Plays a role in virus cell tropism and may be essential for efficient virus replication in macrophages.
Protein Families
Asfivirus MGF 110 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.