Recombinant African swine fever virus Protein MGF 360-10L (Pret-032)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pret-032; Protein MGF 360-10L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Target Names
Pret-032
Target Protein Sequence
MFPSLQSFAKKVLARQHVSIDHHIILERCGLWWYKAPISLDCKHMLIKLPNFADGLDLNT ALMLATKENNYQLIKMFTDWGADINYGLICANTPPVREFCWELGAKYQVDKKKIMHIFFK LIHPSTTSSNIILCLKLFNDNPFSAYVIIREIKSCIHWKLKKLAEDTNVLSNISDGDMLT IYCFIVALQDNLREAISYVYQHFKYLNTWWLTCVLCYNKVFDLHHLYEKEKIRMDMDEMM RIACTKDNNFLTIYYCFILGANINLAMIASIQFYNIDNLFFCIDLGADAFEEAKALAEQR NYFLISHCLSLDIYSPDSSLLTLKEADPNKIYHLLKNYKSKSILAYLNYDVNNTTL
Uniprot No.

Target Background

Function
Plays a role in viral cell tropism and may be essential for efficient viral replication in macrophages.
Protein Families
Asfivirus MGF 360 family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the functional role of MGF 360-10L in ASFV pathogenesis?

MGF 360-10L functions as a crucial virulence factor in ASFV pathogenesis by significantly inhibiting interferon (IFN)-β-triggered STAT1/2 promoter activation and suppressing the production of downstream interferon-stimulated genes (ISGs). This protein is expressed during the early phase of viral infection, coinciding with the expression of other early proteins like p30. Studies comparing wild-type ASFV with MGF 360-10L deletion mutants (ASFV-Δ10L) have demonstrated that viruses lacking this protein exhibit impaired replication capability and significantly reduced virulence both in vitro and in vivo . The protein's primary mechanism involves targeting components of the JAK-STAT signaling pathway, which is essential for mediating immunoregulatory processes and antiviral effects.

How does MGF 360-10L interact with the host immune system?

MGF 360-10L primarily interacts with the host immune system by targeting the JAK-STAT signaling pathway, specifically by mediating the degradation of JAK1 in a dose-dependent manner. When this protein is expressed, it significantly reduces JAK1 protein levels while leaving JAK1 mRNA levels unaffected, indicating regulation at the post-transcriptional level . This targeted degradation of JAK1 subsequently inhibits STAT1 and STAT2 phosphorylation upon IFN-β treatment, effectively blocking downstream signaling cascades. Interestingly, MGF 360-10L appears to selectively target JAK1 while potentially promoting JAK2 expression, which explains why it has minimal effect on IFN-γ-induced activation of the IRF1 promoter, as JAK2 is primarily involved in IFN-γ signaling .

What experimental systems are suitable for studying MGF 360-10L function?

Several experimental systems have proven effective for studying MGF 360-10L function. Cell culture models using porcine alveolar macrophages (PAMs), which are natural targets for ASFV infection, provide a physiologically relevant system. HEK293T cells transfected with plasmids expressing MGF 360-10L have also been successfully used to study the protein's effects on signaling pathways in isolation . Recombinant virus systems comparing wild-type ASFV with MGF 360-10L deletion mutants (ASFV-Δ10L) or fluorescently tagged versions (ASFV-10L-GFP) allow for direct assessment of the protein's role during viral infection. Luciferase reporter assays incorporating STAT1/2 or IRF1 promoter constructs enable quantitative measurement of signaling pathway inhibition. These diverse systems allow researchers to examine MGF 360-10L function from multiple angles, from molecular interactions to effects on viral pathogenesis.

What is the molecular mechanism behind MGF 360-10L-mediated JAK1 degradation?

MGF 360-10L mediates JAK1 degradation through a ubiquitin-proteasome pathway that involves K48-linked ubiquitination at specific lysine residues. Research has demonstrated that MGF 360-10L targets JAK1's lysine residues 245 and 269 for K48-linked ubiquitination by recruiting the E3 ubiquitin ligase HERC5 (HECT and RLD domain-containing E3 ubiquitin protein ligase 5) . This recruitment creates a protein complex that facilitates JAK1 ubiquitination, marking it for proteasomal degradation. The specificity of this interaction suggests a highly evolved mechanism for immune evasion. The process occurs in a dose-dependent manner, with higher levels of MGF 360-10L resulting in more pronounced JAK1 degradation. This targeted degradation effectively blocks STAT1/2 phosphorylation upon IFN-β stimulation, preventing the activation of downstream antiviral genes and allowing for more efficient viral replication.

How do deletion mutants of MGF 360-10L affect virus replication and host immune responses?

Deletion mutants of MGF 360-10L (ASFV-Δ10L) demonstrate significantly impaired replication capability compared to the parental ASFV strain. Studies have shown that in porcine alveolar macrophages infected with ASFV-Δ10L, there is markedly reduced inhibition of JAK1 expression compared to cells infected with the wild-type virus or a GFP-tagged MGF 360-10L virus (ASFV-10L-GFP) . This reduced JAK1 inhibition correlates with higher expression of ISGs in cells infected with ASFV-Δ10L, indicating a more robust antiviral response. In vivo studies further confirm that ASFV-Δ10L exhibits significantly lower virulence than the parental strain, highlighting the protein's importance as a virulence factor . These findings suggest that MGF 360-10L deletion mutants could potentially serve as candidates for attenuated live virus vaccines, as they trigger stronger immune responses while exhibiting reduced pathogenicity.

What are the optimal protocols for expressing and purifying recombinant MGF 360-10L protein?

For optimal expression and purification of recombinant MGF 360-10L protein, researchers should consider several methodological approaches. Based on successful experimental designs in published studies, a recommended protocol includes:

  • Expression System Selection: Mammalian expression systems like HEK293T cells are preferable for maintaining proper protein folding and post-translational modifications. Expression vectors with CMV promoters and epitope tags (FLAG, HA) facilitate detection and purification .

  • Transfection Optimization: For transient expression, lipid-based transfection reagents yield good results with typical DNA concentrations of 0.5-1 μg/mL. Allow 24-48 hours post-transfection for optimal protein expression.

  • Purification Strategy: Implement a two-step purification process:

    • Affinity chromatography using anti-FLAG or anti-HA antibodies conjugated to sepharose beads

    • Size exclusion chromatography to enhance purity

  • Buffer Conditions: Maintain protein stability with buffers containing:

    • 50 mM Tris-HCl (pH 7.5)

    • 150 mM NaCl

    • 10% glycerol

    • Protease inhibitor cocktail

  • Quality Control: Verify purified protein integrity through western blotting and functional assays measuring JAK1 degradation capacity.

When preparing protein for interaction studies, consider maintaining milder elution conditions to preserve protein-protein interaction capabilities.

How can researchers effectively measure the inhibitory effects of MGF 360-10L on JAK-STAT signaling?

Researchers can implement several complementary approaches to measure MGF 360-10L's inhibitory effects on JAK-STAT signaling:

  • Luciferase Reporter Assays: Co-transfect cells with STAT1/2 luciferase reporter plasmids and MGF 360-10L expression vectors in increasing concentrations (0-200 ng). After IFN-β stimulation (typically 1000 U/mL for 6-12 hours), measure luciferase activity to quantify inhibition of promoter activation in a dose-dependent manner .

  • Phosphorylation Analysis: Assess STAT1/2 phosphorylation levels by western blotting using phospho-specific antibodies after IFN-β treatment in the presence or absence of MGF 360-10L. This provides direct evidence of signaling pathway disruption.

  • Gene Expression Analysis: Quantify mRNA levels of ISGs (ISG15, ISG56) using qPCR in cells expressing MGF 360-10L compared to controls, following IFN-β stimulation. This reveals the functional consequences of signaling inhibition .

  • JAK1 Degradation Assays: Monitor JAK1 protein levels using western blotting in cells expressing increasing amounts of MGF 360-10L to establish dose-dependency of the degradation effect.

  • Co-immunoprecipitation Studies: Investigate protein-protein interactions between MGF 360-10L, JAK1, and HERC5 to confirm the recruitment mechanism responsible for JAK1 ubiquitination.

These methodological approaches provide robust and complementary evidence of MGF 360-10L's inhibitory effects on JAK-STAT signaling.

What experimental designs are most effective for studying MGF 360-10L in the context of viral infection?

To effectively study MGF 360-10L in the context of viral infection, researchers should consider these experimental designs:

  • Recombinant Virus Generation: Construct the following viral strains:

    • Wild-type ASFV (ASFV-WT)

    • MGF 360-10L deletion mutant (ASFV-Δ10L)

    • MGF 360-10L tagged virus (ASFV-10L-GFP)

    These allow comparative analysis of MGF 360-10L's contribution to viral replication and pathogenesis .

  • In Vitro Infection Models:

    • Infect porcine alveolar macrophages (PAMs) with different viral strains at various MOIs (0.1-5)

    • Compare viral replication kinetics through qPCR measurement of viral DNA and titration of infectious particles

    • Analyze JAK1 protein levels and ISG expression at different time points post-infection (12, 24, 48 hours)

  • Temporal Expression Analysis:

    • Monitor MGF 360-10L mRNA expression throughout the infection cycle using qPCR

    • Compare with expression kinetics of early (p30) and late viral genes to establish expression timing

  • IFN Response Challenge:

    • Treat infected cells with IFN-β at different time points post-infection

    • Measure STAT1/2 phosphorylation and ISG induction to assess immune evasion efficiency

    • Compare responses between wild-type and mutant viruses

  • In Vivo Pathogenesis Studies:

    • Infect pigs with ASFV-WT and ASFV-Δ10L

    • Monitor clinical signs, viral loads, and survival rates

    • Analyze tissue samples for JAK1 levels and ISG expression

This multi-faceted approach enables comprehensive characterization of MGF 360-10L's role within the viral life cycle and host-pathogen interactions.

How might MGF 360-10L be utilized in the development of attenuated ASFV vaccines?

The potential of MGF 360-10L deletion mutants (ASFV-Δ10L) as attenuated vaccine candidates presents a promising research direction. Studies have demonstrated that viruses lacking MGF 360-10L show significantly reduced virulence compared to wild-type strains while maintaining immunogenicity . This attenuated phenotype stems from their impaired ability to suppress host interferon responses, resulting in improved immune recognition and clearance. Research strategies should focus on:

  • Safety and Stability Assessment: Comprehensive evaluation of genetic stability through multiple passages to ensure the deletion remains consistent and reversion to virulence does not occur.

  • Immunogenicity Profiling: Characterization of both humoral and cell-mediated immune responses to ASFV-Δ10L compared to wild-type virus, with particular attention to neutralizing antibody production and T-cell activation.

  • Cross-Protection Studies: Investigation of protection conferred by ASFV-Δ10L against heterologous ASFV strains, especially currently circulating genotypes.

  • Combination Approaches: Exploration of additional attenuating mutations in combination with MGF 360-10L deletion, potentially targeting other immunomodulatory proteins such as MGF360-4L, to enhance safety while maintaining protective efficacy .

  • Correlates of Protection: Identification of immune markers that correlate with protection following vaccination with ASFV-Δ10L to establish reliable efficacy parameters.

This research direction holds significant potential for addressing the current lack of effective commercial vaccines against ASFV.

What structural characteristics of MGF 360-10L contribute to its immunosuppressive function?

Understanding the structural basis of MGF 360-10L's immunosuppressive function represents a crucial knowledge gap. While functional domains have been partially characterized for some ASFV proteins like MGF360-4L, which has identified critical domains (4L-F2 and 4L-F3) responsible for its immunosuppressive effects , similar detailed structural analysis for MGF 360-10L remains to be completed. Research should focus on:

  • Domain Mapping: Creation of truncated MGF 360-10L constructs to identify specific regions responsible for JAK1 targeting and HERC5 recruitment, similar to the approach used with MGF360-4L .

  • Interaction Interface Analysis: Determination of specific amino acid residues involved in protein-protein interactions with JAK1 and HERC5 through site-directed mutagenesis.

  • Structural Biology Approaches: Application of X-ray crystallography or cryo-electron microscopy to resolve the three-dimensional structure of MGF 360-10L, both alone and in complex with interaction partners.

  • Computational Modeling: Employment of molecular dynamics simulations to predict binding interfaces and structural changes upon complex formation.

  • Cross-Species Comparison: Comparative analysis of MGF 360-10L sequences across different ASFV isolates to identify conserved structural elements that may be essential for function.

This structural information would not only enhance understanding of viral immunomodulation but could also inform the development of targeted antivirals that disrupt MGF 360-10L function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.