Recombinant African swine fever virus Protein MGF 360-10L (War-030)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
War-030; Protein MGF 360-10L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Target Names
War-030
Target Protein Sequence
MFPSLQSFAKKVLARQHVSIDYHVILERCGLWWYKAPISLDCKHMLIKLPSFADGLDLNT ALMLATKENNYQLIKLFTEWGADINYGLICANTPPVRELCWELGAKYRVDKKKIMHMFFK LIHPGTTSSNIILCLKLFNDNPFSAYVIIREIKSSIYWKLKKLVEDTDVLSNISDGDMLT IYCFMVALQDNLREAISYVYQHFKYLNTWWLICALCFNKLFDLHNLYEKEKIRMDMDEMM RIACTKDNNFLTIYYCFILGANINLAMIASIRFYNMDNLFFCIDLGADAFEEAKALAEQR NYFLISHRLSLDIYSPDSSLLTLKEADPNKIYHLLKNYKSKNMTAYFNHDDTI
Uniprot No.

Target Background

Function

Plays a role in virus cell tropism and may be essential for efficient virus replication in macrophages.

Protein Families
Asfivirus MGF 360 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is ASFV MGF 360-10L and what is its role in viral pathogenesis?

ASFV MGF 360-10L is a protein encoded by the multigene family 360 (MGF 360) of African swine fever virus. It functions as a critical virulence factor that enables the virus to escape host innate immunity. According to recent studies, MGF 360-10L significantly inhibits interferon (IFN)-β-triggered STAT1/2 promoter activation and the production of downstream IFN-stimulated genes (ISGs) .

Research has demonstrated that MGF 360-10L primarily targets JAK1 (Janus kinase 1), mediating its degradation in a dose-dependent manner through the ubiquitin-proteasome pathway. This mechanism allows ASFV to suppress host antiviral responses, contributing significantly to its virulence and pathogenicity .

How can researchers generate MGF 360-10L deletion mutants for experimental studies?

To generate MGF 360-10L deletion mutants (ASFV-Δ10L), researchers typically employ CRISPR/Cas9 gene editing technology. The methodology involves:

  • Design of guide RNAs targeting the flanking regions of the MGF 360-10L gene

  • Construction of a homologous recombination donor plasmid containing a selection marker

  • Co-transfection of guide RNAs, Cas9 expression plasmid, and donor plasmid into cells infected with parental ASFV

  • Selection and purification of recombinant viruses

  • Verification of gene deletion by PCR and sequencing

Borca et al. reported that CRISPR/Cas9 gene editing can edit target sequences in the ASFV genome with high precision, improving the purification efficiency of recombinant ASFV . This approach has been successfully used to create deletion mutants for studying the function of specific ASFV genes, including those in the MGF 360 family .

What experimental systems are commonly used to study MGF 360-10L function?

Several experimental systems are commonly employed to study MGF 360-10L:

Experimental SystemApplicationAdvantagesLimitations
HEK293T cellsTransfection studies for protein expression and interactionEasy to transfect, high protein expressionNot natural host cells for ASFV
Porcine alveolar macrophages (PAMs)Virus infection, protein function in natural host cellsPhysiologically relevant, primary target cellsChallenging to culture, donor variability
Luciferase reporter assaysMeasuring STAT1/2 promoter activityQuantitative measurement of signaling pathway inhibitionArtificial system
Western blottingProtein expression and degradation analysisDirect visualization of protein levelsSemi-quantitative
Co-immunoprecipitationProtein-protein interactionsIdentifies binding partnersMay detect indirect interactions
In vivo pig infection modelsVirulence assessmentMost relevant biological systemResource-intensive, ethical considerations

Researchers have successfully used these systems to demonstrate that MGF 360-10L inhibits IFN-β-induced STAT1/2 signaling and mediates JAK1 degradation in both overexpression studies and during ASFV infection .

What is the molecular mechanism by which MGF 360-10L inhibits the host interferon response?

MGF 360-10L employs a sophisticated mechanism to inhibit the host interferon response:

  • JAK1 targeting: MGF 360-10L specifically targets JAK1, a key kinase in the type I interferon signaling pathway .

  • Ubiquitin-mediated degradation: The protein mediates K48-linked ubiquitination of JAK1 at specific lysine residues (K245 and K269) by recruiting the E3 ubiquitin ligase HERC5 (HECT and RLD domain-containing E3 ubiquitin protein ligase 5) .

  • Proteasomal degradation: Following ubiquitination, JAK1 undergoes proteasomal degradation, which is evident from the dose-dependent reduction in JAK1 protein levels when MGF 360-10L is expressed .

  • Inhibition of STAT1/2 phosphorylation: As a consequence of JAK1 degradation, STAT1 and STAT2 phosphorylation is significantly reduced upon IFN-β treatment, preventing the activation of downstream ISG expression .

  • Specificity for type I IFN signaling: Interestingly, MGF 360-10L does not affect IFN-γ-induced activation of the IRF1 promoter, which correlates with the observation that it can actually promote JAK2 expression .

This mechanism represents a strategic viral immune evasion strategy targeting a critical node in the host antiviral response pathway.

How does MGF 360-10L-mediated JAK1 degradation affect viral replication and virulence?

The relationship between MGF 360-10L-mediated JAK1 degradation and ASFV virulence has been extensively investigated:

  • Impaired replication of deletion mutants: ASFV MGF 360-10L deletion mutant (ASFV-Δ10L) shows impaired replication compared to the parental ASFV CN/GS/2018 strain in porcine alveolar macrophages .

  • Enhanced ISG induction: PAMs infected with ASFV-Δ10L exhibit increased expression of ISGs compared to cells infected with the parental strain, indicating a stronger antiviral response .

  • Reduced virulence in vivo: The virulence of ASFV-Δ10L is significantly lower than that of the parental strain in animal models, establishing MGF 360-10L as a critical virulence factor .

  • Viral load and hemadsorption: The hemadsorption (HAD) assay, which allows for determination of viral infectious titers by measuring the adsorption of red blood cells on the surface of ASFV-infected macrophages, reveals that MGF 360-10L deletion affects viral replication capacity .

These findings highlight the crucial role of MGF 360-10L in ASFV pathogenesis and provide insights for potential vaccine development strategies.

How can researchers quantify the inhibitory effect of MGF 360-10L on the STAT1/2 signaling pathway?

Researchers employ several methodological approaches to quantify MGF 360-10L's inhibitory effect on STAT1/2 signaling:

Luciferase Reporter Assays:

  • Transfect HEK293T cells with STAT1/2 luciferase reporter plasmids and increasing amounts of MGF 360-10L expression plasmid

  • Stimulate cells with IFN-β

  • Measure luciferase activity to quantify STAT1/2 promoter activation

  • Calculate percent inhibition relative to empty vector control

Western Blot Analysis of Phosphorylated STAT1/2:

  • Express MGF 360-10L in cells or infect with WT or Δ10L ASFV

  • Stimulate with IFN-β for various time points (usually 15-60 minutes)

  • Detect phosphorylated and total STAT1/2 by immunoblotting

  • Quantify band intensities by densitometry

qRT-PCR Measurement of ISG Expression:

  • Express MGF 360-10L or infect with WT or Δ10L ASFV

  • Stimulate with IFN-β for 6-12 hours

  • Extract RNA and perform qRT-PCR for ISGs (e.g., MX1, OAS1, ISG15)

  • Calculate fold change in gene expression using the 2^-ΔΔCt method

Research has shown that MGF 360-10L inhibits IFN-β-induced STAT1/2 signaling in a dose-dependent manner, with increasing concentrations of the protein leading to greater inhibition of the signaling pathway .

How does MGF 360-10L compare with other ASFV immunomodulatory proteins in the MGF 360 family?

ASFV encodes multiple immunomodulatory proteins within the MGF 360 family, each with distinct mechanisms for immune evasion:

MGF ProteinTarget PathwayMechanismReference
MGF 360-10LJAK-STAT pathwayDegrades JAK1 via HERC5 recruitment and K48-linked ubiquitination
MGF 360-9LJAK-STAT pathwayDegrades STAT1 and STAT2
MGF 360-11LcGAS-STING pathwayDegrades TBK1/IRF7 and inhibits TBK1 and IRF3 phosphorylation
MGF 360-12LNF-κB pathwayCompetitively inhibits interaction between importin α and p65, blocking NF-κB nuclear translocation
MGF 360-4LIFN pathwayInhibits interferon response, interacts with OAS1

This diversity of targets within the host immune system demonstrates a sophisticated viral strategy to comprehensively suppress multiple arms of the innate immune response. The MGF 360 family appears to have evolved to target critical nodes in different signaling pathways, with MGF 360-10L specifically disrupting the JAK-STAT axis, which is central to the interferon response .

What structural and biochemical properties enable MGF 360-10L to mediate JAK1 ubiquitination?

While complete structural data for MGF 360-10L is not available in the search results, biochemical studies have revealed several important features:

  • HERC5 Recruitment: MGF 360-10L recruits the E3 ubiquitin ligase HERC5, suggesting the presence of protein-protein interaction domains that facilitate this recruitment .

  • Specificity for JAK1: The protein shows specificity for JAK1 over other JAK family members (it actually promotes JAK2 expression), indicating selective recognition domains .

  • K48-linked Ubiquitination: MGF 360-10L mediates K48-linked (but not K63-linked) ubiquitination of JAK1, suggesting a specific interaction with ubiquitination machinery that favors this linkage type .

  • Target Lysine Residues: MGF 360-10L directs ubiquitination to specific lysine residues (K245 and K269) on JAK1, indicating a mechanism for precise spatial positioning of the ubiquitination machinery .

Advanced structural studies using techniques such as X-ray crystallography or cryo-electron microscopy would be valuable for elucidating the precise structural basis of these interactions and potentially informing the design of inhibitors that could block MGF 360-10L function.

What are the implications of MGF 360-10L research for ASFV vaccine development strategies?

Understanding MGF 360-10L function has significant implications for vaccine development:

The development of the first commercially available ASF vaccine (ASFV-G-ΔI177L) in Vietnam demonstrates the potential of gene-deleted ASFV strains as vaccine candidates . Similar approaches targeting MGF 360-10L could yield promising results.

What methodologies are optimal for studying the kinetics of JAK1 degradation by MGF 360-10L?

Researchers employ several sophisticated methodologies to study JAK1 degradation kinetics:

Cycloheximide Chase Assay:

  • Treat cells expressing JAK1 and MGF 360-10L with cycloheximide to inhibit new protein synthesis

  • Collect samples at various time points (0-24 hours)

  • Analyze JAK1 protein levels by western blot

  • Quantify protein degradation rate by plotting normalized JAK1 levels against time

  • Calculate half-life using exponential decay models

Pulse-Chase Labeling:

  • Pulse-label newly synthesized proteins with radioactive amino acids

  • Chase with non-radioactive medium for various durations

  • Immunoprecipitate JAK1 and analyze by SDS-PAGE and autoradiography

  • Measure decay of labeled JAK1 to determine degradation kinetics

Ubiquitination Assays:

  • Co-express JAK1, MGF 360-10L, and HA-tagged ubiquitin in cells

  • Immunoprecipitate JAK1 and detect ubiquitinated forms by anti-HA immunoblotting

  • Use proteasome inhibitors (MG132) to accumulate ubiquitinated forms

  • For K48-specific ubiquitination, use ubiquitin mutants where only K48 is available for chain formation

Live-Cell Imaging:

  • Generate fluorescent protein fusions of JAK1 and MGF 360-10L

  • Perform time-lapse confocal microscopy

  • Quantify fluorescence intensity changes over time

  • Calculate protein degradation rates from fluorescence decay curves

Research has shown that MGF 360-10L promotes JAK1 degradation in a dose-dependent manner, with increasing concentrations of MGF 360-10L leading to greater reduction in JAK1 protein levels .

What are the challenges in producing recombinant MGF 360-10L protein for in vitro studies?

Production of recombinant MGF 360-10L presents several technical challenges:

  • Expression System Selection: While bacterial systems like E. coli offer high yield, they may not provide proper folding or post-translational modifications. Eukaryotic systems such as insect cells or mammalian cells might be necessary for functional protein production .

  • Protein Solubility: ASFV proteins can form inclusion bodies when overexpressed, requiring optimization of expression conditions (temperature, induction time) or the addition of solubility tags (MBP, SUMO, GST) .

  • Purification Strategy: Multi-step purification protocols involving affinity chromatography (His-tag, GST-tag), ion exchange, and size exclusion chromatography are typically needed to achieve high purity recombinant protein .

  • Functional Validation: Ensuring the recombinant protein retains its native function is critical. Activity assays measuring JAK1 degradation or ubiquitination must be established to confirm functionality .

  • Stability Concerns: Some viral proteins have limited stability in solution. Buffer optimization (pH, salt concentration, addition of glycerol or reducing agents) may be necessary to maintain protein stability during storage .

Researchers working with recombinant MGF 360-10L should carefully consider these challenges when designing expression and purification strategies.

How can the interaction between MGF 360-10L, JAK1, and HERC5 be visualized and quantified?

Several advanced techniques can be employed to visualize and quantify the protein-protein interactions:

Proximity Ligation Assay (PLA):

  • Fix cells expressing the proteins of interest

  • Use primary antibodies against MGF 360-10L, JAK1, and HERC5

  • Apply secondary antibodies with attached oligonucleotides

  • When proteins are in close proximity (<40 nm), oligonucleotides can be ligated

  • Amplify the ligated DNA and detect with fluorescent probes

  • Quantify interaction by counting fluorescent dots per cell

Fluorescence Resonance Energy Transfer (FRET):

  • Create fusion proteins with donor (e.g., CFP-JAK1) and acceptor (e.g., YFP-MGF 360-10L) fluorophores

  • Measure energy transfer between fluorophores when proteins interact

  • Calculate FRET efficiency to quantify the strength of interaction

  • Perform acceptor photobleaching to confirm specific interaction

Co-Immunoprecipitation with Quantitative Mass Spectrometry:

  • Immunoprecipitate MGF 360-10L and analyze co-precipitated proteins

  • Use stable isotope labeling (SILAC) for quantitative comparison

  • Identify interaction partners by mass spectrometry

  • Quantify relative abundance of JAK1 and HERC5 in the immunoprecipitate

Bioluminescence Resonance Energy Transfer (BRET):

  • Generate fusion proteins with luciferase (donor) and fluorescent protein (acceptor)

  • Measure energy transfer upon substrate addition

  • Calculate BRET ratio to quantify protein interactions

  • Perform saturation assays to determine binding affinity

Research has demonstrated that MGF 360-10L interacts with both JAK1 and HERC5, facilitating the formation of a complex that leads to JAK1 ubiquitination and subsequent degradation .

What are the best model systems for studying the in vivo effects of MGF 360-10L deletion on ASFV pathogenesis?

Several model systems can be employed to study the in vivo effects of MGF 360-10L deletion:

Model SystemAdvantagesLimitationsKey Applications
Domestic pigsNatural host, full disease spectrum, clinically relevantExpensive, requires specialized facilities, ethical considerationsVirulence assessment, vaccine efficacy, immune response characterization
Wild boarNatural host, relevant for understanding sylvatic cycleHard to handle, less standardized than domestic pigsTransmission studies, wildlife reservoir research
Primary porcine alveolar macrophages (PAMs)Natural target cells, maintain physiological responsesDonor variability, limited lifespan, difficult to manipulate geneticallyViral replication kinetics, host response analysis
Porcine cell lines (e.g., CL-2621)More stable than primary cells, easier manipulationMay not fully recapitulate in vivo responsesHigh-throughput screening, mechanistic studies
Humanized mouse modelsSmaller, less expensive than pigsNot natural hosts, may not fully replicate diseasePreliminary screening of attenuation

Research has shown that deletion of MGF 360-10L significantly reduces ASFV virulence in vivo, with animals infected with ASFV-Δ10L showing less severe disease than those infected with the parental strain . This indicates that domestic pigs represent a valuable model system for studying the impact of MGF 360-10L on ASFV pathogenesis.

What emerging technologies could advance our understanding of MGF 360-10L function?

Several cutting-edge technologies could significantly advance MGF 360-10L research:

  • CRISPR-Cas9 Base/Prime Editing: Rather than complete gene deletion, precise modification of MGF 360-10L could reveal functional domains critical for JAK1 interaction and degradation, offering a more nuanced understanding of its mechanism .

  • Cryo-Electron Microscopy: This technology could reveal the structural basis of MGF 360-10L interactions with JAK1 and HERC5, potentially identifying druggable pockets for therapeutic intervention .

  • Proteomics-Based Interactome Analysis: Advanced mass spectrometry techniques could identify the complete set of host proteins that interact with MGF 360-10L beyond JAK1 and HERC5, potentially revealing additional functions .

  • Single-Cell RNA-Seq: This approach could characterize the heterogeneity in host cell responses to MGF 360-10L expression, identifying cell populations particularly susceptible to its immunosuppressive effects .

  • In Situ Proximity Labeling: Techniques like BioID or APEX2 could map the spatial organization of MGF 360-10L within infected cells, identifying compartment-specific interactions .

  • Organoid Models: Porcine macrophage organoids could provide a more physiologically relevant system than traditional cell culture for studying MGF 360-10L function .

  • Computational Modeling: Molecular dynamics simulations and AI-based protein structure prediction (e.g., AlphaFold2) could provide insights into MGF 360-10L-JAK1 interaction dynamics .

Implementing these technologies could reveal new aspects of MGF 360-10L biology and potentially inform novel intervention strategies.

How might understanding MGF 360-10L function contribute to developing antiviral strategies beyond vaccines?

Understanding MGF 360-10L function opens several avenues for antiviral development:

  • Small Molecule Inhibitors: Targeting the interaction between MGF 360-10L and JAK1 or HERC5 with small molecules could prevent JAK1 degradation, preserving the host interferon response during infection .

  • Peptide-Based Inhibitors: Designing peptides that mimic the binding interface between MGF 360-10L and its interaction partners could competitively inhibit these interactions .

  • PROTAC Approach: Proteolysis-targeting chimeras (PROTACs) could be designed to target MGF 360-10L for degradation, turning its own mechanism against it .

  • Host-Directed Therapies: Drugs that enhance JAK-STAT signaling downstream of JAK1 could potentially overcome the immunosuppressive effects of MGF 360-10L .

  • CRISPR-Based Antivirals: CRISPR systems targeting the MGF 360-10L gene could be developed as potential antivirals, specifically disrupting this virulence factor .

  • Combination Therapies: Given the multiple immune evasion mechanisms employed by ASFV, combining inhibitors targeting different viral proteins (e.g., MGF 360-10L and MGF 360-9L) might provide synergistic effects .

Research has shown that MGF 360-10L is a crucial virulence factor, making it an attractive target for antiviral development strategies that aim to enhance host immune control of ASFV infection .

What knowledge gaps remain in our understanding of MGF 360-10L function and regulation?

Despite significant advances, several knowledge gaps remain in our understanding of MGF 360-10L:

  • Structural Information: The three-dimensional structure of MGF 360-10L remains unknown, limiting our understanding of its interaction interfaces with JAK1 and HERC5 .

  • Temporal Regulation: The timing of MGF 360-10L expression during the ASFV replication cycle and how this correlates with JAK1 degradation kinetics requires further investigation .

  • Cell Type Specificity: Whether MGF 360-10L functions differently in various porcine cell types beyond alveolar macrophages remains to be determined .

  • Additional Functions: Potential roles beyond JAK1 degradation that might contribute to viral fitness or host manipulation have not been fully explored .

  • Evolution and Conservation: The evolutionary history of MGF 360-10L across ASFV genotypes and its functional conservation require more detailed analysis .

  • Regulation of MGF 360-10L Activity: Potential post-translational modifications or viral factors that might regulate MGF 360-10L function during infection remain unknown .

  • Cross-Talk with Other Viral Proteins: The functional interaction between MGF 360-10L and other ASFV immunomodulatory proteins, which might reveal synergistic or redundant mechanisms, requires further study .

  • Host Range Determinant: Whether MGF 360-10L contributes to ASFV host range restriction by displaying different effectiveness against JAK1 from various species is unknown .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.