Recombinant African swine fever virus Protein MGF 360-1L (Pret-022)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pret-022; Protein MGF 360-1L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Target Names
Pret-022
Target Protein Sequence
MYFYKKYLHFFFVVSKFKFFLKMQVPFGCNMKGLGVLLGLFSLILAQQLPDLPRTQHPPK
RELKYWCTYVPQCDFCWDCQNGICKNKIMETQLIDSNHSIVNCRVSRNSETQTCFYEISS
KMPNHFSMSCSHPTPYIGNEIFMKKVGGDYMTLLTLKQYCLYFIISIAFAGCFVYAVRKN
LRLNTTIKLLTLLSILVYLAQPVLNRPLSIFYTKQFLPRTYTPPTRELDYWCTYAKHCDF
CWECRKGICKNKVLDDMPPFIIQNDYINKCSIARYFDRCMYFIEPKIPYIHYMNCSLPTY
YG
Uniprot No.
Target Background
Function
Plays a role in viral cell tropism and may be essential for efficient viral replication in macrophages.
Protein Families
Asfivirus MGF 110 family
Subcellular Location
Host membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
