Recombinant African swine fever virus Protein MGF 360-1L (Pret-023)

Shipped with Ice Packs
In Stock

Description

Introduction

African Swine Fever (ASF) poses a significant threat to the global pig industry and public health, caused by the African Swine Fever Virus (ASFV) . ASFV is a large, structurally complex virus with a genome encoding over 160 genes, many of whose functions remain unknown . Recombinant African swine fever virus protein MGF 360-1L (Pret-023) is a protein encoded by the MGF360-1L gene in ASFV . It is found in the African swine fever virus isolate Tick/South Africa/Pretoriuskop Pr4/1996 . Understanding the function of ASFV proteins like MGF 360-1L is crucial for developing antiviral strategies and effective vaccines against ASF .

Characteristics of MGF 360-1L

MGF360-1L is transcribed as a late virus protein . Studies have explored its role in virus replication and virulence . A recombinant ASFV lacking the MGF360-1L gene (ASFV-G-ΔMGF360-1L) was developed to evaluate its essentiality for virus replication .

Role in Virulence

Experiments infecting domestic pigs with ASFV-G-ΔMGF360-1L showed that the pigs presented with a clinical disease indistinguishable from that caused by the parental ASFV-G strain . This demonstrates that MGF360-1L is not involved in virulence in swine, the natural host of ASFV .

MGF360-10L as a Virulence Factor

MGF-360-10L is a novel and crucial virulence factor that mediates ubiquitination and degradation of JAK1 by recruiting the E3 ubiquitin ligase HERC5 . It targets JAK1 and mediates its degradation in a dose-dependent manner in vitro . MGF-360-10L also mediates the K48-linked ubiquitination of JAK1 at lysine residues 245 and 269 by recruiting the E3 ubiquitin ligase HERC5 . The virulence of ASFV with MGF-360-10L deletion was significantly less than the parental ASFV CN/GS/2018, showing that MGF-360-10L is a novel virulence factor of ASFV . Overexpression of MGF-360-10L strongly inhibits the interferon (IFN)-β-induced STAT1/2 signaling pathway and the production of IFN-stimulated genes (ISGs) .

MGF360-9L and its Interaction with Host Proteins

MGF360-9L interacts with signal transducer and activator of transcription (STAT) 1 and STAT2 and degrades STAT1 and STAT2 through apoptosis and ubiquitin-proteasome pathways, respectively . Subsequently, the activation of IFN-β signaling was inhibited . MGF360-9L is a key virulence gene of ASFV . Deletion of MGF360-9L reduces ASFV virulence in pigs .

Potential for Vaccine Development

Creative Biolabs offers Recombinant ASFV Pret-023 Protein (aa 1-130) (Cell Free Expression), which is useful for vaccine development . Live attenuated viruses, whether naturally isolated or genetically manipulated, can protect against virulent parental ASFV strains . MGF-deficient African swine fever virus mutants may be used for vaccine development .

MGF Genes Impact on Host Immune Response

GeneImpact
MGF360-10LOverexpression strongly inhibits the interferon (IFN)-β-induced STAT1/2 signaling pathway and the production of IFN-stimulated genes (ISGs) .
MGF360-9LInteracts with signal transducer and activator of transcription (STAT) 1 and STAT2 and degrades STAT1 and STAT2 through apoptosis and ubiquitin-proteasome pathways, respectively .
MGF family genesModulate the host immune response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pret-023; Protein MGF 360-1L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Target Names
Pret-023
Target Protein Sequence
MKAFLGFLLLSYLAIILVHDNVNCIIFGIFDPCFYKISSKISNDYSSMQCSHPISYIGYE MFIQKWKDDNYWPLIIRHCCFYLVFSIAFASCVAFAIRRNLHLSTTMKLLGLLSILVWLA QPVLNQPFPT
Uniprot No.

Target Background

Function

Plays a role in virus cell tropism and may be essential for efficient virus replication in macrophages.

Protein Families
Asfivirus MGF 110 family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and basic characteristics of ASFV MGF360-1L?

MGF360-1L is the first gene encoded in the African swine fever virus (ASFV) genome, located on the negative strand between positions 852 and 1934 in the ASFV-G genome . This positioning at the extreme left end of the genome suggests potential importance in early viral processes. The protein belongs to the multigene family 360 (MGF360) cluster, with MGF360-1L proteins varying significantly in length across different ASFV isolates, ranging from 122 to 160 amino acids .

Notably, sequence analysis reveals that MGF360-1L lacks conserved regions across all viral isolates, which is consistent with its absence in some ASFV strains including ASFV E75, Mkuzi_1975, Ken06_Bus, and Malawi isolates . In the case of ASFV E75, a fusion protein combining MGF360-1L and MGF360-2L is present instead of the discrete MGF360-1L gene.

How is MGF360-1L expressed during ASFV infection?

MGF360-1L follows a late protein expression pattern during the viral replication cycle. Transcriptional analysis using microarray data has demonstrated that MGF360-1L RNA is first detectable at approximately 3 hours post-infection in primary swine macrophages infected with ASFV-G . Following initial detection, transcript levels continue to increase throughout the remainder of the infection cycle .

This transcriptional pattern resembles that of the well-characterized ASFV early protein p30 (CP204L), suggesting MGF360-1L may play a role in the transition from early to late stages of viral replication . The methodological approach for studying MGF360-1L expression typically involves:

  • Infection of primary swine macrophages with ASFV

  • RNA extraction at different time points post-infection

  • Transcriptional analysis via microarray or RT-qPCR

  • Protein detection using specific antibodies for Western blotting or immunofluorescence

How does sequence variation in MGF360-1L impact experimental approaches?

The significant sequence variation observed in MGF360-1L across ASFV isolates necessitates careful consideration when designing experiments. Multiple sequence alignments using programs like the Viral Bioinformatics Research Center's Viral Orthologous Clusters program and CLC Genomics Workbench have revealed substantial diversity in MGF360-1L proteins .

When working with this protein, researchers should:

  • Determine the specific sequence of MGF360-1L in their ASFV isolate of interest

  • Design primers or antibodies that account for sequence variation

  • Consider using conserved regions (if any) for broader detection across isolates

  • Include appropriate strain-specific positive controls

  • When interpreting results, account for potential functional differences due to sequence variations

What experimental design approaches are most effective for studying MGF360-1L function?

Robust experimental design for studying MGF360-1L function should incorporate pretest-posttest methodologies to accurately assess the protein's role in viral replication and pathogenesis. A comprehensive approach includes:

Randomized Control Group Pretest-Posttest Design:
This approach randomly assigns experimental units (cells or animals) to treatment or control groups, with measurements taken before and after intervention . For MGF360-1L studies, this might involve:

  • Random assignment of swine macrophages to experimental groups

  • Pretest measurement of baseline cellular parameters

  • Intervention (e.g., expression of recombinant MGF360-1L or infection with wild-type vs. deletion mutant virus)

  • Posttest measurement of outcomes

  • Statistical analysis using paired t-tests or similar methods to determine significance

This design effectively controls for confounding variables and provides robust evidence of MGF360-1L function by comparing changes between pretests and posttests across treatment and control groups.

How can gene deletion studies be optimized when investigating MGF360-1L?

Gene deletion studies offer powerful insights into MGF360-1L function, as demonstrated by previous work developing recombinant ASFV lacking the gene (ASFV-G-ΔMGF360-1L) . Key methodological considerations include:

  • Precise deletion design: Ensure the deletion targets only MGF360-1L without disrupting adjacent genes or regulatory elements.

  • Verification of deletion: Confirm deletion using PCR, sequencing, and transcriptional analysis to verify complete removal of the target gene.

  • Comparative analysis: Compare replication kinetics between wild-type and deletion mutants in relevant cell types (primary swine macrophages preferred over cell lines).

  • In vivo assessment: Evaluate virulence, replication, and pathogenesis in swine models using the deletion mutant compared to parental virus.

  • Long-term stability testing: Assess genomic stability of the deletion mutant across multiple passages to detect potential compensatory mutations or genomic reorganizations, as observed with other ASFV deletion mutants .

What approaches should be used to analyze data from MGF360-1L studies?

Data from MGF360-1L studies should be analyzed using appropriate statistical methods based on study design and data type. For experimental outcomes comparing wild-type and mutant viruses, consider:

  • Meta-analysis approaches: When comparing results across multiple studies, apply weighted statistical combination methods as described in Cochrane methodology . This is particularly valuable given the variation in MGF360-1L across ASFV isolates.

  • Effect size calculations: Choose appropriate effect measures (risk ratios, mean differences) based on outcome type (dichotomous, continuous) .

  • Heterogeneity assessment: Evaluate variation across experimental replicates using methods like the I² statistic and explore potential sources of heterogeneity .

  • Sensitivity analysis: Test robustness of findings by examining effects of potentially influential decisions in data processing and analysis .

  • Graphical presentation: Present comparative data in tables rather than lists, with appropriate visualization of variation.

How does MGF360-1L contribute to ASFV pathogenesis compared to other multigene family proteins?

MGF360-1L's role in ASFV pathogenesis should be evaluated in context with other multigene family proteins. While direct evidence for MGF360-1L's function in pathogenesis remains limited, comparative analysis with other MGF proteins provides valuable insights:

Table 1: Comparative Analysis of Selected ASFV Multigene Family Proteins

ProteinGenomic LocationEffect on Viral ReplicationHost Interaction TargetsRole in PathogenesisReference
MGF360-1LFirst gene in genome (852-1934)Under investigationUnknownUnder investigation
MGF300-4LLeft variable regionReduction in viral replication when deletedIKKβ degradation via CMA; inhibits IκBα ubiquitinationPromotes virulence by inhibiting NF-κB pathway and reducing pro-inflammatory cytokines
MGF360-12L, -13L, -14LVariable regionInvolved in ASFV-G virulenceUnknownPart of ASFV-G-ΔMGF attenuation
MGF505-1R, -2R, -3RVariable regionInvolved in ASFV-G virulenceUnknownPart of ASFV-G-ΔMGF attenuation

Unlike MGF300-4L, which has been demonstrated to inhibit production of proinflammatory cytokines IL-1β and TNF-α through interaction with the NF-κB signaling pathway , the specific host interaction targets and pathogenic mechanisms of MGF360-1L remain to be fully characterized.

Methodologically, comparative analysis should include:

  • Side-by-side evaluation of individual gene deletions

  • Combination deletions to assess potential functional redundancy

  • Proteomics approaches to identify host interaction partners

  • Systems biology analysis of affected cellular pathways

What considerations are important when developing recombinant MGF360-1L for vaccine studies?

Development of recombinant MGF360-1L for vaccine applications requires careful consideration of several key factors:

  • Sequence selection: Given the variability in MGF360-1L across ASFV isolates, selection of representative sequences or consensus designs may be necessary. Currently available recombinant proteins, such as ASFV Pret-023 Protein (aa 1-130), represent specific isolates and may not provide broad protection .

  • Expression system optimization: Cell-free expression systems have been successfully used to produce recombinant MGF360-1L , but comparative studies with other expression platforms (bacterial, mammalian, insect) should be considered for optimal yield and proper folding.

  • Safety assessment: Potential reversion to virulence must be evaluated following VICH guideline 41 protocols, similar to those used for ASFV-G-ΔMGF vaccine candidate . This involves:

    • Multiple animal passages of recombinant viruses

    • Monitoring clinical signs, virus replication, and shedding

    • Whole-genome sequencing to detect genomic changes

  • Whole-genome stability monitoring: When developing recombinant ASFV vaccines containing MGF360-1L modifications, continuous monitoring for genomic reorganization is essential, as evidenced by the emergence of the ΔMGFnV variant with an 11,197 bp deletion and 18,592 bp duplication during animal passage studies .

How can genomic instability in MGF360-1L regions be monitored in live attenuated vaccine candidates?

Genomic instability in the MGF360-1L region and other parts of the ASFV genome presents a significant challenge for live attenuated vaccine development. Effective monitoring requires:

  • Sequential whole-genome sequencing: Perform complete genome sequencing after each animal passage to detect deletions, insertions, or reorganizations, as demonstrated in the ASFV-G-ΔMGF studies .

  • Targeted qPCR assays: Develop tailored quantitative PCR assays to detect specific genomic variants that may emerge during passaging. For example, researchers detected the ΔMGFnV variant using a specific qPCR design with FAM and HEX channel detection .

  • Growth kinetics assessment: Compare replication patterns of parental and variant viruses in cell culture, as differences in cq values can indicate competitive advantages of emerging variants .

  • Long-term in vivo stability studies: Extend standard reversion-to-virulence protocols to assess genomic stability over multiple passages in the target species.

What are the primary technical challenges in studying MGF360-1L function?

Research on MGF360-1L faces several technical challenges that require specialized methodological approaches:

  • Sequence diversity management: The variable nature of MGF360-1L across ASFV isolates necessitates strain-specific approaches and complicates development of broadly applicable reagents .

  • Functional redundancy assessment: Potential functional overlap with other MGF proteins requires careful experimental design, including multiple gene deletions and complementation studies.

  • Primary cell culture requirements: Studies should prioritize primary swine macrophages over established cell lines to maintain biological relevance, despite the technical challenges of primary culture .

  • Biosafety considerations: ASFV research requires appropriate biosafety containment facilities, limiting research capacity.

  • Protein structure determination: The lack of conserved domains in MGF360-1L complicates structural prediction and functional annotation .

How can contradictory results in MGF360-1L studies be reconciled through meta-analysis?

When faced with contradictory results across MGF360-1L studies, researchers should apply systematic meta-analysis approaches:

  • Weighted effect estimation: Apply weighted averaging of effect estimates from different studies, accounting for sample size and study quality .

  • Heterogeneity exploration: Analyze sources of variation between studies, including virus strain differences, experimental conditions, and methodological variations .

  • Random-effects modeling: When significant heterogeneity exists, use random-effects meta-analyses that assume underlying effects follow a normal distribution .

  • Prediction intervals: Present prediction intervals from random-effects meta-analyses to illustrate the extent of between-study variation .

  • Sensitivity analysis: Test whether findings are robust to potentially influential decisions in study selection and data analysis .

What future research directions should be prioritized for MGF360-1L?

Based on current knowledge gaps, future MGF360-1L research should prioritize:

  • Host interaction partner identification: Apply techniques such as yeast two-hybrid screens, co-immunoprecipitation followed by mass spectrometry, or proximity labeling approaches to identify cellular proteins that interact with MGF360-1L.

  • Comparative functional genomics: Conduct systematic comparisons of MGF360-1L function across diverse ASFV isolates to understand evolutionary adaptations.

  • Structure-function analysis: Determine the three-dimensional structure of MGF360-1L to guide rational design of inhibitors or vaccine candidates.

  • Immunomodulatory role assessment: Investigate whether MGF360-1L influences host immune responses similar to MGF300-4L, which inhibits NF-κB signaling .

  • Combination deletion studies: Explore potential synergistic effects of MGF360-1L deletion with other attenuating mutations for optimized vaccine development.

  • Cross-protective immunity evaluation: Assess whether immune responses targeting MGF360-1L provide protection against diverse ASFV isolates despite sequence variation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.