Recombinant African swine fever virus Transmembrane protein B169L (Ken-088)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your application.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
Ken-088; Transmembrane protein B169L; pB169L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Target Names
Ken-088
Target Protein Sequence
MNVDFIAGINNLGEKIYTCEPFKTSFQNPFIVALIITAVVLVVFFAICNPPVDKKRKTKT AIYIYICIVALLFLHYYVLNHQLNDIYNKSNMDVIVSSIHDKYKGGDEIIPPVSPPSVPD ELEEDRPKMIPAGSKPADFKPAEPAVSKPLIPLQEVIMPSQYNN
Uniprot No.

Target Background

Protein Families
Asfivirus B169L family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the confirmed structural organization of the B169L protein in ASFV?

The B169L protein of African swine fever virus (ASFV) contains an integral membrane helical hairpin. Advanced bioinformatics analyses have confirmed that B169L anchors to the endoplasmic reticulum (ER) membrane, with both terminal ends facing the lumen of the organelle. This hairpin transmembrane domain (HTMD) adopts α-helical conformations when reconstituted into lipid bilayers, as verified through infrared spectroscopy. Expression studies using GFP fusion proteins have demonstrated that B169L inserts into the ER as a Type III membrane protein and forms oligomers within this cellular compartment .

What is the confirmed functional role of B169L in the ASFV life cycle?

B169L functions as a class IIA viroporin, a virus-encoded protein that forms pores in host membranes. Single vesicle permeability assays have demonstrated that B169L transmembrane helices assemble lytic pores in ER-like membranes. This pore-forming ability has been further confirmed through ion-channel activity measurements in planar bilayers. Importantly, this activity appears to be specific to B169L, as similar pore-forming activities were not observed in transmembrane helices derived from EP84R, another ASFV protein with a predicted α-helical HTMD . The viroporin function suggests B169L plays an essential role in viral replication or assembly processes.

How does the B169L gene expression pattern characterize its role during infection?

Transcriptome analysis has revealed that B169L exhibits a complex expression pattern. The gene possesses alternative transcription start sites (TSSs), with a bona fide primary TSS upstream of the annotated start codon and an alternative TSS within the gene. This suggests potential differential expression or production of protein variants at different stages of viral infection. Genome-wide CAGE-seq and RNA-seq data analyses indicate that ASFV genes, including B169L, show specific temporal expression patterns between early and late infection stages, pointing to a tightly regulated gene expression program during the viral life cycle .

What are the recommended approaches for studying B169L membrane integration and oligomerization?

To study B169L membrane integration and oligomerization, researchers should consider the following methodological workflow:

  • Fusion protein expression systems: Generate GFP fusion constructs of B169L and express them in mammalian cells without signal peptides to assess natural membrane insertion.

  • Subcellular localization: Use confocal microscopy with ER markers to confirm localization.

  • Membrane reconstitution: Synthesize overlapping peptides spanning the B169L HTMD and reconstitute them into ER-like membrane systems.

  • Structural analysis: Apply infrared spectroscopy to analyze the secondary structure of the reconstituted peptides.

  • Oligomerization assessment: Use techniques such as blue native PAGE, chemical crosslinking, or FRET to detect protein-protein interactions indicating oligomer formation .

This multi-technique approach provides comprehensive data on both the localization and structural properties of the protein within cellular membrane environments.

What experimental design is most effective for characterizing the viroporin activity of B169L?

An effective experimental design for characterizing B169L viroporin activity should include:

Experimental ComponentSpecific ParametersMeasurementsControls
Vesicle permeability assaysER-like lipid composition; peptide concentrations (1-20 μM)Fluorescent dye leakage; kinetics of membrane permeabilizationNegative: EP84R transmembrane peptides; Positive: known viroporins
Planar bilayer recordingsVoltage range (-80 to +80 mV); different ionic conditionsSingle-channel conductance; ion selectivity; gating characteristicsBuffer-only; scrambled-sequence peptides
Functional mutagenesisTargeted mutations in predicted pore-lining residuesChanges in pore activity; oligomerization capacityWild-type B169L HTMD peptides

This comprehensive approach allows for detailed characterization of the pore-forming properties of B169L at both the biophysical and functional levels . Measurements should be performed in triplicate at minimum, with statistical analysis of variation between replicates.

How can transcriptomic approaches be optimized for studying B169L expression patterns during ASFV infection?

To optimize transcriptomic approaches for studying B169L expression patterns, researchers should implement:

  • Temporal resolution: Sample collection at multiple time points (e.g., 2h, 5h, 8h, 12h, 16h post-infection) to capture the dynamic changes in expression.

  • Complementary techniques: Combine CAGE-seq (for precise TSS mapping) with RNA-seq (for gene body coverage) and 3' RNA-seq (for termination site identification).

  • Normalization strategies: Apply appropriate normalization methods to account for the increasing viral RNA levels during late infection, which can mask relative expression changes.

  • Differential expression analysis: Use tools like DESeq2 with stringent statistical cutoffs (adjusted p-value ≤0.05) to identify significant changes.

  • Validation: Confirm key findings using targeted approaches such as qRT-PCR or Northern blotting .

This integrated approach provides robust data on temporal expression patterns and alternative transcription start site usage, which are critical for understanding B169L regulation during infection.

What methodologies are recommended for evolutionary analysis of the B169L gene across ASFV isolates?

For comprehensive evolutionary analysis of the B169L gene across ASFV isolates, the following methodological approach is recommended:

  • Sequence acquisition: Perform exhaustive BLAST searches using reference sequences (e.g., ASFV isolate Georgia NC_044959.2) to retrieve representative B169L sequences across different genotypes.

  • Model selection: Determine the appropriate evolutionary model using the Bayesian Information Criterion (BIC) score. The Tamura 3-parameter model has been validated for B169L analysis (BIC score: 2862.031).

  • Phylogenetic tree construction: Apply the maximum likelihood method with 1000 bootstrap replicates to ensure statistical support for the topology.

  • Genetic distance calculation: Conduct pairwise distance analyses using the p-distance model with 1000 bootstrap replicates for standard error determination.

  • Software implementation: Utilize MEGA version 10.2.5 for consistency in phylogenetic and distance analyses .

This systematic approach enables researchers to determine the evolutionary relationships between B169L variants and identify conserved regions that may be functionally significant.

How does purifying selection shape B169L conservation across ASFV genotypes?

Evolutionary analysis has confirmed the importance of purifying selection in preserving identified domains during the evolution of B169L in nature. This selective pressure maintains the functional integrity of the protein across diverse ASFV isolates spanning multiple genotypes (I, II, IV, V, VIII, IX, X, XV, and XX), suggesting that B169L plays an essential role in the viral life cycle .

Analysis should examine sequence conservation patterns in specific functional regions, particularly:

  • The transmembrane hairpin domain residues that are crucial for membrane insertion

  • Amino acids involved in oligomerization interfaces

  • Charged or polar residues that might line the ion channel pore

Regions under strong purifying selection represent potential targets for antiviral strategies, as they are less likely to tolerate mutations that could lead to resistance.

How can structure-function relationships in B169L inform antiviral drug design?

Structure-function relationships in B169L can inform antiviral drug design through the following research pathway:

  • Structural characterization: Determine high-resolution structures of the B169L transmembrane domain using techniques such as NMR spectroscopy or cryo-electron microscopy of reconstituted protein in membrane mimetics.

  • Functional mapping: Identify critical residues for:

    • Membrane insertion and folding

    • Oligomerization interfaces

    • Ion conduction pathway

    • Potential gating mechanisms

  • Druggable site identification: Target specific regions:

    Target SitePotential MechanismDrug Design Strategy
    Pore lumenChannel blockadeSmall molecules that physically occlude the ion-conducting pathway
    Oligomerization interfacesPrevention of multimer formationPeptides or small molecules that disrupt protein-protein interactions
    Allosteric sitesConformational stabilizationCompounds that lock the channel in a non-conducting state
  • Validation strategies: Employ electrophysiology, membrane permeabilization assays, and viral replication assays to confirm that candidate compounds effectively inhibit B169L function and ASFV replication .

This rational drug design approach targeting the viroporin activity of B169L could yield novel antiviral compounds against ASFV, addressing a significant need in swine health management.

What implications does B169L's viroporin activity have for ASFV pathogenesis models?

The viroporin-like function of B169L has significant implications for understanding ASFV pathogenesis:

  • Membrane permeabilization: B169L's ability to form lytic pores in ER membranes suggests it may contribute to:

    • Disruption of cellular calcium homeostasis

    • Activation of ER stress responses

    • Alteration of protein trafficking pathways

    • Potential triggering of apoptotic cascades

  • Viral assembly: As a transmembrane protein with both terminal ends in the ER lumen, B169L may:

    • Facilitate viral envelope formation

    • Participate in virion morphogenesis

    • Contribute to the architecture of the mature virion

  • Host-pathogen interaction: The ion channel activity could:

    • Modulate host immune responses

    • Alter cellular metabolism to favor viral replication

    • Contribute to cytopathic effects observed in infected cells

These mechanisms should be incorporated into comprehensive models of ASFV pathogenesis, potentially explaining aspects of cellular damage and tissue tropism observed during infection.

What are the key technical challenges in studying B169L function in the context of live ASFV infection?

Key technical challenges in studying B169L function during live ASFV infection include:

  • BSL-3 containment requirements: ASFV is a high-consequence pathogen requiring specialized facilities, limiting widespread research.

  • Genetic manipulation difficulties:

    • The large genome size (160-170 kb) complicates genetic engineering

    • Limited availability of efficient reverse genetics systems for ASFV

    • Potential lethality of B169L mutations if the gene is essential

  • Cell culture limitations:

    • Restricted host cell range in vitro

    • Variable growth kinetics across cell types

    • Challenges in maintaining primary swine macrophages (natural host cells)

  • Functional redundancy:

    • Potential overlapping functions with other ASFV membrane proteins

    • Difficulty in isolating B169L-specific effects from general viral pathogenesis

  • Temporal dynamics:

    • Need for precise timing of observations during the viral replication cycle

    • Coordinating B169L expression with other viral proteins

Addressing these challenges requires innovative approaches combining targeted mutagenesis, complementation studies, and development of cell-based assays that isolate specific aspects of B169L function.

How might alternative transcription start sites of B169L influence protein variant production and functional diversity?

The identification of alternative transcription start sites (TSSs) for B169L, including a bona fide primary TSS upstream of the annotated start codon and an alternative TSS within the gene itself, suggests complex regulatory mechanisms that could generate protein variants with distinct functions . This phenomenon warrants further investigation through:

  • Transcript characterization: Quantify the relative abundance of transcripts from each TSS using targeted RT-PCR and RNA-seq analysis across infection time points.

  • Protein variant identification: Employ techniques such as:

    • Western blotting with antibodies targeting different regions of B169L

    • Mass spectrometry to identify and quantify protein variants

    • N-terminal sequencing to confirm translation initiation sites

  • Functional differentiation: Compare activities of full-length and potential truncated variants:

    Protein VariantExpected PropertiesFunctional Implications
    Full-length B169LComplete transmembrane hairpinStandard viroporin activity; possible regulatory domains
    N-terminally truncatedModified membrane topologyAltered ion selectivity or gating properties
    Internal initiation variantsDifferent subcellular targetingPotentially distinct roles in viral replication cycle
  • Temporal regulation: Determine if the usage of alternative TSSs changes throughout infection, potentially indicating stage-specific functions of different B169L variants .

Understanding this complexity could reveal sophisticated viral strategies for maximizing the functional output from a single genetic locus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.