Recombinant African swine fever virus Transmembrane protein B169L (Pret-088)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant African Swine Fever Virus Transmembrane Protein B169L (Pret-088)

The B169L protein, also referred to as pB169L, is a structural protein of the African swine fever virus (ASFV) . Its function during virus replication was previously unknown . The B169L protein is associated with the endoplasmic reticulum (ER) membrane and contains a hairpin transmembrane domain (HTMD) . The protein is expressed at low levels early in the virus replication cycle, with transcription progressively increasing at later stages .

Structure and Properties

  • B169L has two predicted transmembrane helices (TMHs) connected by a short stretch, anchoring the protein to cell membranes in a Nout/Cout topology .

  • It lacks a signal peptide, suggesting it translocates into the ER as a type III membrane protein .

  • The hairpin transmembrane domain (HTMD) of B169L exhibits viroporin-like activity, forming lytic pores in ER-like membranes .

  • The B169L protein is encoded by the B169L gene within the ASFV genome .

Viroporin-like Function

B169L's HTMD functions as a class IIA viroporin . Viroporins are small viral proteins that modify cellular membranes, facilitating virus release . B169L transmembrane sequences adopt $$\alpha$$-helical conformations in lipid bilayers, assembling into lytic pores in ER-like membranes . Pore-forming activity was confirmed through single vesicle permeability assays and ion-channel activity measurements in planar bilayers .

Gene Transcription and Expression

The B169L gene is transcribed during the ASFV replication cycle . Transcription of B169L begins at 4 hours post-infection (hpi) and increases until 24 hpi . The B169L gene expression pattern parallels that of the late protein p72 (B646L) and the early protein p30 (CP204L) .

Role in African Swine Fever Virus

ASFV causes a highly lethal hemorrhagic disease in domestic and wild pigs, leading to significant economic losses . The B169L protein is essential for virus replication, acting as a membrane-associated protein with a viroporin function . It inserts into ER membranes, potentially using its first transmembrane helix as a signal anchor to initiate insertion . B169L contributes to the formation of non-infectious core-less icosahedral particles, displaying a significant DNA-packaging defect .

B169L and B438L Gene Transcription

The B169L gene is located upstream of the B438L gene, with short intergenic regions separating their sequences . The distal promoter of the B438L gene initiates transcription of both the B438L mRNA and an alternatively spliced B169L mRNA (B169L mRNA2) . This mRNA encodes a truncated pB169L (tpB169L) consisting of amino acids 92–169 . Mutation of the initiation codon upstream of the alternatively spliced B169L gene increases gene transcription efficiency .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
Pret-088; Transmembrane protein B169L; pB169L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)
Target Names
Pret-088
Target Protein Sequence
MNVDFIAGINNLGEKIYTCEPFKTSFQNPFIVALIITAVVLVVFFAICNPPVDKKRKTKT AIYVYICIVALLFLHYYVLNHQLNDIYNKSNMDVIVSSIHDKYKGGDEIIPPISPPSVSN ELEEDQPKKIAAGSKPADSKPADSKPASSADSKPLVPLQEVIMPSQYNN
Uniprot No.

Target Background

Protein Families
Asfivirus B169L family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the ASFV B169L (Pret-088) protein?

B169L is an integral membrane protein encoded by the African swine fever virus genome and has been confirmed as a structural component of the virus particle through proteomic analyses . The protein contains a hairpin transmembrane domain (HTMD) consisting of two transmembrane helices spanning approximately amino acids 29-49 and 62-80, connected by a short stretch of amino acids (50-61) . This structure allows B169L to adopt an N-terminus out/C-terminus out topology when anchored to cellular membranes . Advanced structural prediction tools such as DeepTMHMM confirm this hairpin transmembrane arrangement, which is characteristic of class IIA viroporins .

What is the cellular localization of B169L protein?

B169L is predicted to translocate into the endoplasmic reticulum (ER) as a type III membrane protein . Notably, the protein lacks a signal peptide, as revealed by computational analysis using DeepLoc 2.0 and LA(ProtT5) prediction tools . Expression studies with GFP fusion proteins have supported this prediction, demonstrating that B169L can insert into the ER membrane even without a signal peptide, with both terminal ends facing the lumen of the organelle . This localization pattern is consistent with its proposed function in viral replication and assembly processes.

What is the source of recombinant B169L (Pret-088) protein?

Recombinant B169L protein can be produced in expression systems such as E. coli . The recombinant protein is derived from the African swine fever virus isolate Tick/South Africa/Pretoriuskop Pr4/1996 . For research applications, the protein can be expressed as a partial sequence with specific tags to facilitate purification and detection in experimental settings. It's important to note that commercially available recombinant proteins for research can only be used for laboratory investigations and not for direct therapeutic applications in humans or animals .

How conserved is the B169L gene across different ASFV isolates?

The B169L gene shows notable conservation across different ASFV genotypes, suggesting its functional importance. Phylogenetic analysis using representative ASFV isolates from genotypes I, II, IV, V, VIII, IX, X, XV, and XX has demonstrated evolutionary relationships between different viral strains . Analysis conducted using the maximum likelihood method and the Tamura 3-parameter model, with topology supported by 1000 bootstrap replicates, provides insights into the genetic diversity of this gene in nature . The conservation pattern observed suggests that B169L plays a critical role in the viral life cycle, making it a potentially valuable target for diagnostic and therapeutic interventions.

What evidence supports the viroporin-like function of B169L?

Multiple experimental approaches provide evidence for B169L functioning as a class IIA viroporin:

  • Infrared spectroscopy structural determinations: Overlapping peptides spanning the B169L HTMD were reconstituted into ER-like membranes, and the adopted structures were analyzed by infrared spectroscopy. These experiments confirmed that B169L transmembrane sequences adopt α-helical conformations in lipid bilayers, consistent with viroporin structure predictions .

  • Single vesicle permeability assays: These demonstrated that B169L transmembrane helices can assemble lytic pores in ER-like membranes .

  • Ion-channel activity measurements: Tests in planar bilayers confirmed the ion channel formation capacity of B169L .

  • Comparative analysis: When compared with transmembrane helices derived from another ASFV protein (EP84R) that also has a HTMD structure but lacks pore-forming activity, B169L showed distinct functional characteristics, emphasizing the specificity of its viroporin activity .

These combined approaches provide strong experimental evidence for the viroporin-like function of B169L, suggesting its role in modifying membrane permeability during viral infection.

What methodologies are effective for studying B169L membrane integration and pore formation?

Several complementary methodologies have proven effective for studying B169L's membrane properties:

  • Synthetic peptide reconstitution: Overlapping synthetic peptides derived from B169L sequences can be purchased and reconstituted into membrane systems. Peptide concentrations can be determined using bicinchoninic-acid microassay, with storage in small aliquots (typically 20 μL, 1 mg/mL) in DMSO at freezing temperatures to maintain integrity .

  • Model membrane systems: Phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylinositol (PI) can be used to create ER-like membranes for reconstitution experiments .

  • Fluorescence-based assays: Fluorescent probes like Alexa Fluor 488 and N-(lissamine Rhodamine B sulfonyl) phosphatidylethanolamine (N-Rh-PE) enable visualization and quantification of membrane permeability events .

  • Electrophysiology: Planar bilayer experiments allow direct measurement of ion channel formation and activity, providing functional evidence for pore formation .

  • Expression systems with cellular localization markers: GFP fusion proteins can be used to track B169L localization in cellular contexts and study oligomerization properties .

These methodologies provide a comprehensive toolkit for researchers investigating the membrane integration, structural characteristics, and pore-forming functions of B169L.

How does B169L differ from other ASFV membrane proteins?

B169L has distinct characteristics that differentiate it from other ASFV membrane proteins:

  • Structural comparison with B117L: While B117L is described as a class IA viroporin containing a single-pass transmembrane helix, B169L contains a hairpin transmembrane domain (HTMD) characteristic of class IIA viroporins .

  • Expression timing: B169L presents an ambivalent early-late expression profile, unlike B117L which appears to be expressed late during infection. This suggests that B169L may have additional regulatory functions that occur prior to viral morphogenesis .

  • Functional comparison with EP84R: Both B169L and EP84R contain HTMDs and anchor to the ER membrane, but experimental evidence shows that only B169L has pore-forming activity. This functional distinction is significant despite structural similarities .

  • Evolutionary conservation: The conservation patterns of B169L across ASFV isolates reflect its functional importance and potential role in viral replication and assembly.

These differences highlight the specialized function of B169L within the ASFV proteome and underscore its potential importance as a therapeutic target.

How can researchers detect B169L gene expression during ASFV infection?

Researchers can detect B169L gene expression using quantitative PCR methods. Specific primers and probes designed using the ASFV Georgia 2007/1 strain (GenBank Accession #NC_044959.2) sequence are effective for this purpose . The following primers and probe can be used:

  • Forward primer: 5'-TGAATGTAGATTTTATTGCGGGTATC-3'

  • Reverse primer: 5'-AGGCCACAATGAAAGGATTTTG-3'

  • Probe: 5'-FAM-AGGATGTTTTGAACGGTTCGCACG-MGB-NFQ-3'

These can be used in comparison with other ASFV genes such as CP204L (p30, an early gene) and B646L (p72, a late gene) to characterize the temporal expression pattern of B169L during infection . This approach enables researchers to track B169L expression kinetics and understand its role in the viral replication cycle.

What computational tools are useful for predicting B169L protein features?

Several computational tools have proven valuable for B169L analysis:

  • DeepTMHMM: A non-homology-based program effective for predicting transmembrane helices in the B169L sequence and determining their topology .

  • DeepLoc 2.0: Useful for cellular localization predictions, helping to establish B169L's likely translocation into the ER .

  • LA(ProtT5): Provides complementary cellular localization predictions to support experimental hypotheses .

  • BLAST: Essential for identifying homologous sequences across different ASFV isolates for comparative analysis .

  • Maximum likelihood evolutionary algorithms: Tools like SLAC, FEL, MEME, and FUBAR are valuable for inferring selection pressures acting on B169L during evolution .

  • Phylogenetic analysis software: Programs such as Mega version 10.2.5 enable comprehensive evolutionary analysis, including the construction of phylogenetic trees and calculation of genetic distances .

These computational resources provide a strong foundation for generating hypotheses about B169L structure and function that can be subsequently validated through experimental approaches.

What are the potential epitopes in B169L for vaccine development?

While specific epitopes within B169L are not detailed in the available search results, the computational approaches described in the literature can be applied to identify potential epitopes. A comprehensive analysis of ASFV protein sequences using immunoinformatic tools can identify both experimentally validated epitopes from the Immune Epitope Database and de novo predicted sequences .

For epitope prediction in transmembrane proteins like B169L, researchers should:

  • Map predicted epitopes to assess their positioning relative to the membrane, retaining only those facing outward or in extracellular/luminal domains .

  • Prioritize epitopes based on evolutionary conservation, presence in virulent and currently circulating variants (like Georgia 2007/1), and lack of identity to either the pig proteome or putative proteins from pig gut microbiota .

  • Distinguish between potential B-cell epitopes and T-cell epitopes (both CD4+ and CD8+) to develop a comprehensive vaccine strategy .

This approach aligns with reverse vaccinology strategies that leverage genomic and proteomic data to identify promising vaccine candidates.

How might B169L viroporin activity contribute to ASFV pathogenesis?

The viroporin-like activity of B169L suggests several potential contributions to ASFV pathogenesis:

  • Membrane permeabilization: By forming ion-permeable pores in ER membranes, B169L could alter cellular ion homeostasis, potentially contributing to cell stress and death during infection .

  • Viral assembly facilitation: As B169L is incorporated into virus particles and has an ambivalent early-late expression profile, it may play roles both in viral replication and in the assembly of infectious virions .

  • Immune response modulation: Viroporins can influence host cell signaling pathways and immune responses. While specific effects of B169L on host immunity aren't detailed in the available data, this represents an important area for future investigation.

  • Host range determination: The conservation of B169L across ASFV isolates suggests it may be important for viral fitness across different host contexts, potentially contributing to the virus's ability to infect and cause disease in various swine populations.

Understanding these potential pathogenic mechanisms could provide insights for developing targeted antiviral strategies against ASFV.

What are the implications of B169L oligomerization for drug design?

The evidence that B169L can form oligomers in the ER membrane has significant implications for drug design :

  • Target identification: The oligomerization interfaces between B169L monomers could represent specific targets for small molecule inhibitors that prevent proper complex assembly.

  • Pore-blocking strategies: Compounds that bind to the assembled pore and block ion conductance could inhibit B169L function without necessarily preventing protein expression or oligomerization.

  • Allosteric inhibition: Molecules that bind to regions of B169L that undergo conformational changes during oligomerization could allosterically prevent proper pore formation.

  • Structure-based drug design: Detailed structural characterization of B169L oligomers would enable rational design of molecules that specifically interact with and inhibit protein function.

These approaches could lead to the development of antivirals that specifically target B169L viroporin activity as part of a comprehensive strategy against ASFV infection.

What are the potential interactions between B169L and host cellular factors?

Although specific host interactions aren't detailed in the available search results, the membrane localization and viroporin activity of B169L suggest several potential interactions with host factors:

  • ER stress responses: As a protein that integrates into the ER membrane and forms pores, B169L might trigger or modulate unfolded protein responses or other ER stress pathways.

  • Ion homeostasis machinery: By forming ion-permeable channels, B169L could interact functionally (though not necessarily physically) with cellular ion pumps and channels that attempt to maintain proper ionic balance.

  • Membrane remodeling factors: During viral assembly, B169L might interact with host factors involved in membrane curvature and remodeling.

  • Innate immune sensors: Viroporins from other viruses have been shown to activate or inhibit innate immune pathways. Similar interactions might exist for B169L.

These potential interactions represent important areas for future research, as they could reveal new insights into ASFV pathogenesis and identify additional targets for therapeutic intervention.

What are the most promising research directions for B169L-based ASFV interventions?

Based on current knowledge, several promising research directions emerge:

  • Structure-function studies: More detailed structural characterization of B169L oligomers and pores would enable rational design of inhibitors and enhance understanding of viroporin mechanism.

  • Epitope-based vaccine development: Building on computational approaches to identify conserved, exposed epitopes in B169L could contribute to multi-epitope vaccine formulations against ASFV .

  • Small molecule screening: High-throughput screening for compounds that inhibit B169L pore formation or function could yield candidate antivirals.

  • Host-pathogen interaction studies: Identifying specific host factors that interact with B169L could reveal new therapeutic targets and enhance understanding of ASFV pathogenesis.

  • In vivo functional studies: Investigating the effects of B169L mutations or deletions on ASFV replication and pathogenesis in animal models would clarify its role in infection.

These research directions have the potential to contribute to both fundamental understanding of ASFV biology and the development of practical interventions against this economically devastating disease.

How might B169L research contribute to broader understanding of viroporins?

Research on B169L can advance understanding of viroporins in several ways:

  • Evolutionary insights: As a viroporin from a DNA virus with a complex structure, B169L offers an interesting comparison point to the more studied viroporins from RNA viruses like influenza M2 or HIV Vpu.

  • Structure-function relationships: The hairpin transmembrane domain structure of B169L provides an opportunity to understand how this specific architectural arrangement contributes to pore formation and ion selectivity.

  • Membrane interaction dynamics: Studies of how B169L inserts into and modifies membranes can provide general insights into protein-lipid interactions relevant to many membrane proteins.

  • Host response mechanisms: Investigating how cells respond to B169L expression and membrane permeabilization can reveal general principles of host responses to viroporins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.