Recombinant African swine fever virus Transmembrane protein B169L (Ba71V-076)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Ba71V-076; B169L; Transmembrane protein B169L; pB169L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Target Names
Ba71V-076
Target Protein Sequence
MNVDFIAGINNLGEKIYTCEPFKTSFQNPFIVALIITAVVLVVFFAICNPPVDKKRKTKT AIYVYICIVALLFLHYYVLNHQLNDIYNKSNMDVIVSSIHDKYKGGDEIIPPISPPSVSN ELEEDQPKKIPAGPKPAGPKPADSKPASSADSKPLVPLQEVIMPSQYNN
Uniprot No.

Target Background

Database Links

KEGG: vg:22220306

Protein Families
Asfivirus B169L family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the basic structural organization of the B169L transmembrane protein?

B169L is a 169-amino acid transmembrane protein encoded by the African swine fever virus (ASFV). Advanced bioinformatics analyses using DeepTMHMM have confirmed the presence of two transmembrane helices (TMHs) spanning approximately amino acids 29-49 and 62-80, connected by a short stretch (amino acids 50-61). This forms an alpha-helical hairpin transmembrane domain (HTMD) that anchors the protein to cellular membranes with an Nout/Cout topology . The protein lacks a signal peptide, suggesting it translocates into the endoplasmic reticulum as a type III membrane protein, using its first TMH (preceded by only 28 amino acids) as a 'Nexo' signal anchor to initiate insertion .

How does sequence variability in B169L affect its structure among different ASFV isolates?

Sequence analysis of ASFV isolates from Cameroon has revealed a consistent deletion (GCTTTGGACCGGCCG) within the B169L gene compared to reference strains. This deletion results in the removal of one copy of three PAGPK repeats within the protein . This finding suggests that repetitive sequences within B169L may be hotspots for variation across different geographical isolates. For comprehensive characterization of B169L variants, researchers should perform comparative sequence analysis across multiple isolates using next-generation sequencing followed by bioinformatic analyses focused on repetitive regions, which could serve as molecular markers for epidemiological studies.

What is the transcription kinetics pattern of the B169L gene during ASFV infection?

The transcriptional activity of B169L follows a complex pattern beginning relatively early in the virus replication cycle. In experimental infections of primary swine macrophages with ASFV strain Georgia (MOI=10), B169L transcription was first detected at 4 hours post-infection (hpi) and steadily increased until 24 hpi . Quantitative analysis using qPCR and expression of 2^ΔΔCt values shows that B169L has transcription kinetics that parallels both early protein p30 (CP204L) and late protein p72 (B646L), suggesting a bi-phasic expression pattern . The table below summarizes comparative transcription patterns in the presence of DNA synthesis inhibitor AraC:

GeneMacrophage control mock treated 2^ΔΔCt (Log 10)Macrophage AraC treated 2^ΔΔCt (Log 10)Log 10 difference after treatment
B646L (p72)1 × 10^6.321 × 10^3.141 × 10^3.18
CP204L (p30)1 × 10^7.561 × 10^5.741 × 10^1.82
B169L1 × 10^5.591 × 10^3.651 × 10^1.94

These data indicate that while B169L has late-phase expression characteristics similar to p72, it also shows significant early transcription activity comparable to p30, as evidenced by similar differences in gene expression between AraC-treated and mock-treated cultures .

How is B169L transcription regulated at the genomic level?

Recent research has identified a previously unknown transcriptional mechanism for B169L involving the distal promoter of the B438L gene. This promoter initiates the transcription of both the B438L mRNA and an alternatively spliced B169L mRNA (designated as B169L mRNA2) . Using luciferase reporter assays, researchers identified specific DNA fragments (designated as B438L-1, -3, and -5) that exhibited robust promoter activities upon ASFV-P61 infection . This finding reveals a complex transcriptional regulation mechanism where a single promoter controls the expression of multiple ASFV genes. For researchers studying B169L expression, it is essential to consider both its own promoter and the influence of the B438L distal promoter when designing expression constructs or analyzing transcriptional data.

What are the membrane localization properties of B169L?

Confocal microscopy studies using B169L-GFP fusion constructs have demonstrated that B169L preferentially localizes to the endoplasmic reticulum (ER) when expressed in cells . This localization pattern was confirmed through co-transfection with markers for the ER, plasma membrane, and mitochondria. Interestingly, truncated versions of B169L (starting at Met92) or alternative fusion constructs with GFP at the N-terminus (GFP-B169L) showed non-preferential distribution similar to GFP alone, suggesting that specific structural elements in the full-length protein are crucial for proper ER targeting . For researchers studying B169L localization, it is recommended to use C-terminal tags and preserve the native N-terminal sequence to maintain proper membrane targeting.

What is the viroporin-like activity of B169L and how can it be experimentally demonstrated?

B169L functions as a class IIA viroporin through its hairpin transmembrane domain (HTMD). This activity has been demonstrated through multiple complementary experimental approaches:

  • Reconstitution experiments: Overlapping peptides spanning the B169L HTMD were reconstituted into ER-like membranes, and the structures were analyzed by infrared spectroscopy, confirming the adoption of α-helical conformations in lipid bilayers .

  • Membrane permeability assays: Single vesicle permeability assays demonstrated the assembly of lytic pores in ER-like membranes by B169L transmembrane helices .

  • Ion-channel activity measurements: Planar bilayer experiments confirmed pore-forming capabilities of B169L .

  • Negative controls: Similar experiments with transmembrane helices derived from another ASFV protein (EP84R) predicted to anchor to membranes through an α-helical HTMD did not show pore-forming activities, highlighting the specificity of B169L's viroporin function .

For researchers investigating similar viroporin activities in other viral proteins, this multi-method approach combining structural analysis, permeability assays, and electrophysiological measurements provides a robust experimental framework.

How does B169L contribute to ASFV replication and pathogenesis?

B169L appears to be an essential component of ASFV replication machinery through its viroporin function. By forming pores in the ER membrane, B169L likely facilitates the movement of ions and small molecules necessary for viral replication. The timing of B169L expression, beginning at early phases and increasing through late phases of infection, suggests it plays roles in both the establishment of infection and virion assembly .

The viroporin activity specifically targets the ER, which is a critical organelle for ASFV replication factory formation. By manipulating ER permeability, B169L may contribute to the reorganization of host cell membranes required for viral replication complex assembly. This function may be particularly important in African swine fever (ASF) pathogenesis, as the disease causes widespread economic problems in the pork industry globally, especially with recent spread throughout Eurasia .

How do recombinant variants of B169L differ functionally from the wild-type protein?

While specific functional comparisons between recombinant and wild-type B169L have not been extensively documented in the provided literature, recombinant versions of B169L with tags (such as His-tag) are available for research purposes . These recombinant variants allow for easier purification and detection in experimental settings but may have altered functional properties compared to the native protein.

The emergence of recombinant ASFV strains, particularly those containing genotypes I and II as reported in Vietnam in 2023, suggests potential genetic variability that could affect B169L function . For definitive functional comparisons, researchers should conduct side-by-side assays of membrane permeabilization, ion channel activity, and oligomerization using both wild-type and recombinant versions of B169L under identical experimental conditions.

What methods are recommended for studying B169L oligomerization in membrane environments?

B169L forms oligomers in the ER membrane as part of its viroporin function. To study this oligomerization process, researchers should consider the following methodological approaches:

  • GFP fusion protein expression: Transfection of cells with B169L-GFP constructs followed by confocal microscopy can visualize oligomer formation in cellular contexts .

  • Infrared spectroscopy: Analysis of reconstituted B169L peptides in lipid bilayers can confirm α-helical conformations essential for oligomerization .

  • Crosslinking assays: Chemical crosslinking followed by SDS-PAGE and Western blot analysis can identify oligomeric states.

  • FRET analysis: Fluorescence resonance energy transfer between differently labeled B169L monomers can provide dynamic information about oligomerization in living cells.

  • Single-particle cryo-electron microscopy: For structural characterization of oligomeric pores at near-atomic resolution.

Each method provides complementary information about the oligomerization process, and combining multiple approaches yields the most comprehensive understanding of B169L assembly in membranes.

How can B169L be targeted in antiviral drug development strategies against ASFV?

As a viroporin with essential functions in viral replication, B169L represents a promising target for antiviral development. Researchers should consider the following strategic approaches:

  • High-throughput screening: Develop assays based on B169L ion channel activity in artificial membranes to screen compound libraries for potential inhibitors.

  • Structure-based drug design: Using the predicted structure of B169L's transmembrane domains, perform in silico screening to identify molecules that could block pore formation or function.

  • Peptide inhibitors: Design peptides that mimic B169L transmembrane segments but incorporate modifications that prevent proper oligomerization when co-assembled with native protein.

  • Small molecule viroporin inhibitors: Test known inhibitors of other viral viroporins (such as M2 inhibitors for influenza) for activity against B169L.

  • Combination approaches: Target B169L alongside other essential ASFV proteins to create synergistic antiviral effects and reduce the likelihood of resistance development.

Given the devastating economic impact of ASFV on the global pork industry and the emergence of recombinant strains that could complicate current control measures , developing B169L-targeted antivirals represents a valuable research direction.

What is the recommended protocol for detecting B169L transcription during ASFV infection?

Based on successful experimental approaches documented in the literature, researchers should follow this protocol for B169L transcription analysis:

  • Infection setup:

    • Culture porcine macrophages and infect with ASFV at MOI of 10

    • Collect RNA samples at multiple time points (0-8 hours post-infection and 24 hours post-infection)

    • Include early (CP204L/p30) and late (B646L/p72) reference genes

  • RNA extraction and processing:

    • Extract RNA using RNeasy Kit (QIAGEN)

    • Treat with DNase I (2 units)

    • Purify using RNA Cleanup Kit

    • Convert 1 μg RNA to cDNA using SuperMix

  • Quantitative PCR:

    • Design primers specific for B169L gene:

      • Forward: 5'-TGAATGTAGATTTTATTGCGGGTATC-3'

      • Reverse: 5'-AGGCCACAATGAAAGGATTTTG-3'

      • Probe: 5'-FAM-AGGATGTTTTGAACGGTTCGCACG-MGB-NFQ-3'

    • Use TaqMan Universal PCR Master Mix

    • Amplification conditions: 55°C for 2 min, 95°C for 10 min, followed by 40 cycles of 95°C for 15 s and 65°C for 1 min

  • Data analysis:

    • Express transcription as relative quantities of mRNA accumulation (2^ΔΔCt)

    • Normalize using β-actin gene expression

    • Establish background threshold based on DNase-treated samples

This comprehensive approach allows for accurate detection and quantification of B169L transcription dynamics throughout the viral replication cycle.

How can recombinant B169L protein be effectively expressed and purified for structural and functional studies?

For optimal expression and purification of recombinant B169L protein, researchers should consider the following protocol:

  • Expression system selection:

    • For full-length protein: Consider mammalian expression systems (HEK293 or CHO cells) to maintain proper membrane protein folding

    • For soluble domains: E. coli expression with appropriate tags (His-tag has been successfully used)

  • Expression construct design:

    • For membrane studies: Maintain native N-terminus and add C-terminal tag

    • For soluble domain studies: Express specific regions (e.g., aa 1-169 has been documented)

    • Consider codon optimization for the expression system

  • Purification strategy:

    • For detergent-solubilized full-length protein:

      • Solubilize membranes with mild detergents (DDM, LMNG)

      • Purify by affinity chromatography using the tag

      • Further purify by size exclusion chromatography

    • For inclusion body refolding (if using E. coli):

      • Solubilize inclusion bodies with denaturants

      • Refold by gradual dialysis in the presence of lipids/detergents

      • Verify proper folding by circular dichroism

  • Quality control:

    • Verify purity by SDS-PAGE

    • Confirm identity by western blot and/or mass spectrometry

    • Assess functionality through membrane incorporation assays and ion channel measurements

This strategic approach addresses the challenges of membrane protein expression while maximizing yield and maintaining functional integrity for downstream applications.

What are the key unresolved questions about B169L that require further investigation?

Despite recent advances in understanding B169L function, several critical questions remain unanswered:

  • Structural details: What is the high-resolution structure of B169L oligomers in membrane environments, and how does this structure relate to its viroporin function?

  • Host interactions: Does B169L interact with specific host proteins in the ER, and how do these interactions contribute to viral replication?

  • Ion selectivity: What is the ion selectivity profile of B169L pores, and how does this contribute to viral replication and pathogenesis?

  • Regulation: How is B169L activity regulated during infection, and are there viral or cellular factors that modulate its function?

  • Strain variation: How do sequence variations in B169L across different ASFV strains (including recently emerged recombinant strains) affect its function and contribution to virulence?

Addressing these questions will require interdisciplinary approaches combining structural biology, virology, cell biology, and biophysics.

How might B169L research contribute to the development of new ASFV control strategies?

Research on B169L has significant potential to advance ASFV control strategies through multiple avenues:

  • Vaccine development: Understanding B169L's role in viral replication and immunity could inform the design of attenuated or subunit vaccines. The emerging recombinant ASFV strains in Vietnam (2023) that complicate current control measures highlight the need for broadly effective vaccines .

  • Antiviral therapeutics: As a viroporin with essential functions, B169L represents a promising target for small molecule inhibitors that could block viral replication.

  • Diagnostic tools: The sequence variations in B169L across different ASFV isolates, such as the deletions observed in Cameroon strains , could be exploited for the development of improved molecular diagnostic assays.

  • Predictive modeling: Understanding how B169L contributes to viral fitness could help predict the emergence and spread of new ASFV variants.

  • Host resistance strategies: If B169L interacts with specific host factors, these interactions could be targeted to develop swine breeds with enhanced resistance to ASFV infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.