Recombinant African swine fever virus Transmembrane protein B169L (Mal-084)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant African Swine Fever Virus Transmembrane Protein B169L (Mal-084)

African swine fever (ASF) is a highly contagious and deadly disease affecting domestic and wild pigs, causing significant economic damage in affected regions . The causative agent, African swine fever virus (ASFV), possesses a large DNA genome encoding over 150 proteins, many of which have unknown functions . Among these proteins is the B169L protein (pB169L), a structural component of ASFV that is not well-characterized . Recombinant African swine fever virus Transmembrane protein B169L (Mal-084) refers to the B169L protein produced using recombinant DNA technology .

B169L Protein: Structure and Function

The B169L protein is an integral membrane protein, meaning it is embedded within the cell membranes of ASFV-infected cells . Bioinformatics analyses predict that B169L contains two transmembrane helices (TMHs) connected by a short loop, forming a hairpin transmembrane domain (HTMD) . This HTMD anchors the protein to the endoplasmic reticulum (ER) membrane, with both ends of the protein facing the organelle's lumen .

Recent research suggests B169L possesses viroporin-like activity, meaning it can form pores in cell membranes . Experiments have shown that the transmembrane helices of B169L can assemble into lytic pores in ER-like membranes, allowing ions to pass through . This pore-forming activity is not observed in other ASFV proteins with similar transmembrane domains, highlighting the unique function of B169L .

B169L Gene Transcription and Expression

The B169L gene is transcribed during the ASFV replication cycle . Studies using quantitative PCR (qPCR) have shown that B169L transcription is detectable at 4 hours post-infection (hpi) and increases steadily until 24 hpi . The expression pattern of B169L is similar to that of the late ASFV protein p72 (B646L), although B169L also exhibits an early phase of transcription .

Experimental Data

The following table summarizes data related to B169L gene expression in ASFV-infected cells treated with AraC, an inhibitor of DNA replication :

GeneMacrophage control mock treated 2^ΔΔCt (Log 10)Macrophage AraC treated 2^ΔΔCt (Log 10)Log 10 difference after treatment
B646L (p72)1 × 10^6.321 × 10^3.141 × 10^3.18
CP204L (p30)1 × 10^7.561 × 10^5.741 × 10^1.82
B169L1 × 10^5.591 × 10^3.651 × 10^1.94

These data indicate that B169L, similar to the early protein p30, has an early phase of transcription that is less affected by AraC treatment compared to the late protein p72 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Mal-084; Transmembrane protein B169L; pB169L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) (ASFV)
Target Names
Mal-084
Target Protein Sequence
MNVDFIAGINNLGEKIYTCEPFKTSFQNPFIVALIITAVVLVVFFAICNPPVDKKRKTKT AIYLYICIVALLFLHYYVLNHQLNDIYNKSNMDVIVSSIHDKYKGGDEIIPPVSPPSISN ELEEDRPKKILAGSKLAGLADSKPAEPAVSKPLVPLQEVIMPSQYNN
Uniprot No.

Target Background

Protein Families
Asfivirus B169L family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the B169L protein?

B169L is a transmembrane protein of African swine fever virus with a predicted molecular weight of approximately 36.1-38 kDa . It contains an integral membrane helical hairpin structure with both terminal ends facing the lumen of the endoplasmic reticulum (ER) . The protein is composed of 347 amino acids and features a conserved N-terminal transmembrane domain and a C-terminal cytoplasmic domain . Bioinformatics analysis confirms the presence of α-helical conformations when the protein is reconstituted in lipid bilayers, consistent with its role as a membrane-associated protein .

What is the cellular localization of B169L during ASFV infection?

B169L inserts into the ER as a Type III membrane protein, which has been confirmed through experiments using GFP fusion proteins in the absence of a signal peptide . This localization is critical for its function, as it forms oligomers within the ER membrane . The protein appears to anchor to the ER membrane through its hairpin transmembrane domain (HTMD), with both N and C-terminal regions oriented toward the ER lumen . This specific orientation is important for understanding its role in viral replication and assembly processes.

What is the transcription timing of the B169L gene during ASFV infection?

Time course experiments in primary swine macrophages infected with ASFV strain Georgia (MOI=10) have revealed that B169L transcription is detectable at 4 hours post-infection (hpi) and increases steadily until 24 hpi . Its expression pattern parallels both early protein p30 (CP204L) and late protein p72 (B646L) . This indicates that B169L starts being expressed at low levels relatively early in the virus replication cycle and progressively increases in expression at later stages, following a pattern similar to typical late genes like B646L .

How does B169L function as a viroporin?

B169L functions as a class IIA viroporin through its hairpin transmembrane domain (HTMD) . Experimental evidence demonstrates that B169L transmembrane sequences form lytic pores in ER-like membranes, confirmed through single vesicle permeability assays . The protein's ion-channel activity has been measured in planar bilayers, further supporting its viroporin function . Importantly, these pore-forming activities were not observed in transmembrane helices derived from EP84R (another ASFV membrane protein), highlighting the specificity of B169L's viroporin activity .

What experimental approaches are used to study B169L's viroporin activity?

Multiple complementary techniques are used to characterize B169L's viroporin activity:

  • Infrared spectroscopy: Used to analyze the structure of overlapping peptides spanning the B169L HTMD reconstituted into ER-like membranes .

  • Single vesicle permeability assays: Applied to demonstrate the assembly of lytic pores in ER-like membranes .

  • Ion-channel activity measurements: Performed in planar bilayers to confirm pore formation and ion conductance .

  • GFP fusion protein expression: Used to study protein localization and oligomerization in the absence of a signal peptide .

These methods collectively provide robust evidence for B169L's function as a membrane-permeabilizing protein with viroporin-like activity.

How can recombinant B169L protein be produced for research applications?

Recombinant B169L protein is typically expressed in prokaryotic systems, particularly in E. coli . The protein can be produced with various tags for purification and detection purposes, such as an N-terminal GST tag, resulting in a fusion protein with a predicted molecular weight of 36.1 kDa . For optimal stability, the purified protein is often formulated in PBS (pH 7.4) with additives like 0.02% NLS, 1mM EDTA, 4% Trehalose, and 1% Mannitol before lyophilization . When handling the recombinant protein, it's recommended to reconstitute to a concentration higher than 100 μg/ml in distilled water and aliquot the solution to minimize freeze-thaw cycles .

How conserved is the B169L protein among different ASFV isolates?

Evolutionary analysis has confirmed the importance of purifying selection in preserving identified domains during the natural evolution of B169L . This suggests strong functional constraints on the protein structure. The B169L protein shows approximately 97% sequence identity among different ASFV strains, indicating high conservation . This conservation level underscores the protein's essential role in the viral life cycle and makes it a potentially valuable target for broad-spectrum antiviral strategies or diagnostics.

How does B169L compare to other viral transmembrane proteins with similar functions?

While B169L functions as a class IIA viroporin, it differs from other ASFV membrane proteins like EP84R, which is predicted to anchor to membranes through an α-helical HTMD but lacks pore-forming capabilities . This distinction highlights the specialized function of B169L. When compared to viroporins from other virus families, B169L shares functional similarities but has unique structural properties specific to ASFV. Understanding these differences is crucial for developing targeted antiviral strategies that exploit the unique characteristics of B169L.

What role might B169L play in ASFV pathogenesis and virus-host interactions?

As a viroporin with membrane-permeabilizing capabilities, B169L likely contributes to viral pathogenesis through several potential mechanisms:

  • Altering host cell membrane permeability to facilitate viral release

  • Modulating ion homeostasis within infected cells

  • Potentially triggering cellular stress responses or apoptotic pathways

  • Participating in the formation of viral factories or assembly sites

These functions could impact virus-host interactions at multiple levels, from individual cell responses to systemic disease progression. Future research exploring these interactions could provide valuable insights into ASFV pathogenesis mechanisms.

How might targeting B169L contribute to antiviral strategies against ASFV?

Given its essential role in viral replication and membrane permeabilization, B169L represents a promising target for antiviral strategies in veterinary medicine . Potential approaches include:

  • Small molecule inhibitors: Compounds that specifically block the pore-forming activity of B169L could inhibit viral replication.

  • Peptide-based inhibitors: Designed peptides that interfere with B169L oligomerization or membrane insertion.

  • Antibody-based approaches: Antibodies that recognize and neutralize B169L function.

  • Vaccine development: Recombinant B169L or B169L-derived epitopes could potentially elicit protective immune responses against ASFV.

Research focusing on these strategies could contribute to controlling ASFV, a devastating disease causing significant economic impact in the pork industry globally.

What techniques are most effective for detecting B169L gene expression during ASFV infection?

Quantitative PCR (qPCR) has been effectively used to detect and quantify B169L gene expression during ASFV infection . The methodology involves:

  • RNA extraction: Using commercial kits (e.g., RNeasy Kit from QIAGEN) from infected cell cultures at various time points post-infection .

  • DNase treatment: Treatment with DNase I (typically 2 units) to eliminate viral DNA contamination, followed by RNA purification .

  • cDNA synthesis: Using commercial systems like qScript cDNA SuperMix (Quanta bio) .

  • Primer and probe design: For B169L from ASFV Georgia 2007/1 strain, the following have been used successfully :

    • Forward primer: 5'- TGAATGTAGATTTTATTGCGGGTATC-3′

    • Reverse primer: 5'- AGGCCACAATGAAAGGA TTTTG-3′

    • Probe: 5′-FAM-AGGATGTTTTGAACGGTTCGCACG-MGB-NFQ-3′

  • Reference genes: Using β-actin for normalization and comparing expression patterns with known early (CP204L/p30) and late (B646L/p72) viral genes .

This approach allows for accurate monitoring of B169L transcription kinetics throughout the viral replication cycle.

What are the current technical challenges in studying B169L function in vitro?

Several technical challenges exist in studying B169L function:

  • Membrane protein handling: As a transmembrane protein, B169L can be difficult to work with in its native conformation outside of a membrane environment.

  • Functional assays: Developing robust assays to measure viroporin activity in physiologically relevant contexts.

  • Structural determination: Obtaining high-resolution structural data for membrane proteins is technically challenging.

  • Virus-specific challenges: Working with ASFV requires specialized containment facilities due to its classification as a high-consequence pathogen.

Addressing these challenges requires specialized techniques in membrane protein biochemistry and appropriate biosafety measures.

What future research directions could enhance our understanding of B169L function?

Several promising research directions could advance our understanding of B169L:

  • High-resolution structural studies: Cryo-EM or X-ray crystallography of B169L to elucidate its precise structural organization.

  • Mutagenesis studies: Systematic mutation of key residues to identify those critical for viroporin activity and oligomerization.

  • Interaction studies: Identifying host and viral proteins that interact with B169L during the infection cycle.

  • In vivo studies: Examining the effects of B169L mutations on viral pathogenesis in appropriate animal models.

  • Inhibitor development: High-throughput screening for compounds that specifically inhibit B169L function.

These approaches would provide a more comprehensive understanding of B169L's role in ASFV biology and could lead to novel control strategies for this devastating disease.

How might novel detection methods for B169L contribute to ASFV diagnostics?

As B169L is highly conserved among ASFV strains, it represents a promising target for diagnostic test development. Potential approaches include:

  • PCR-based detection: Targeting the conserved regions of the B169L gene for sensitive and specific virus detection.

  • Serological tests: Using recombinant B169L protein to detect anti-B169L antibodies in infected animals.

  • Rapid antigen tests: Developing monoclonal antibodies against B169L for use in point-of-care diagnostic platforms.

  • Biosensor approaches: Novel detection platforms that can specifically identify B169L protein or gene sequences.

These diagnostic approaches could enhance surveillance and control efforts for ASFV, which remains a significant threat to the global swine industry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.